FLJ23834 Antibody

Images

 
Immunohistochemistry-Paraffin: FLJ23834 Antibody [NBP1-88100] - Staining of human bronchus shows strong cytoplasmic positivity in respiratory epithelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FLJ23834 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LTQMPKWKESSHQGAAPRRVTAGEGMGSLRSANWEEDELSGKAWAEDAGLGSRNEGGKLGNPKNRNPAFMNRAYPKPHPGK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CDHR3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
FLJ23834 Protein (NBP1-88100PEP)
Publications
Read Publication using
NBP1-88100 in the following applications:

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 25848009).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FLJ23834 Antibody

  • Cadherin-like protein 28
  • cadherin-related family member 3
  • CDH28MGC133292
  • FLJ23834
  • FLJ43271
  • FLJ44366
  • MGC133293

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for FLJ23834 Antibody (NBP1-88100)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: ICC/IF, WB.


Filter By Application
ICC/IF
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for FLJ23834 Antibody (NBP1-88100) (0)

There are no reviews for FLJ23834 Antibody (NBP1-88100). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for FLJ23834 Antibody (NBP1-88100) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FLJ23834 Products

Bioinformatics Tool for FLJ23834 Antibody (NBP1-88100)

Discover related pathways, diseases and genes to FLJ23834 Antibody (NBP1-88100). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on FLJ23834

There are no specific blogs for FLJ23834, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FLJ23834 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CDHR3