![Immunohistochemistry-Paraffin: FLJ23834 Antibody [NBP1-88100] - Staining of human skeletal muscle shows no positivity in myocytes as expected.](http://images.novusbio.com/fullsize/FLJ23834-Antibody-Immunohistochemistry-Paraffin-NBP1-88100-img0013.jpg "Immunohistochemistry-Paraffin: FLJ23834 Antibody [NBP1-88100] - Staining of human skeletal muscle shows no positivity in myocytes as expected.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit FLJ23834 Antibody - BSA Free (NBP1-88100) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-FLJ23834 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LTQMPKWKESSHQGAAPRRVTAGEGMGSLRSANWEEDELSGKAWAEDAGLGSRNEGGKLGNPKNRNPAFMNRAYPKPHPGK |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CDHR3 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
| Publication using NBP1-88100 | Applications | Species |
|---|---|---|
| Bochkov YA, Watters K, Ashraf S et al. Cadherin-related family member 3, a childhood asthma susceptibility gene product, mediates rhinovirus C binding and replication. Proc Natl Acad Sci U S A 2015-04-28 [PMID: 25848009] (WB, ICC/IF, Human) | WB, ICC/IF | Human |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CDHR3 |
![Immunohistochemistry-Paraffin: FLJ23834 Antibody [NBP1-88100] - Staining of human bronchus shows moderate cytoplasmic positivity in respiratory epithelial cells.](http://images.novusbio.com/fullsize/FLJ23834-Antibody-Immunohistochemistry-Paraffin-NBP1-88100-img0010.jpg "Immunohistochemistry-Paraffin: FLJ23834 Antibody [NBP1-88100] - Staining of human bronchus shows moderate cytoplasmic positivity in respiratory epithelial cells.")
![Immunohistochemistry-Paraffin: FLJ23834 Antibody [NBP1-88100] - Staining of human fallopian tube shows weak to moderate positivity in apical membrane and cilia in glandular cells.](http://images.novusbio.com/fullsize/FLJ23834-Antibody-Immunohistochemistry-Paraffin-NBP1-88100-img0011.jpg "Immunohistochemistry-Paraffin: FLJ23834 Antibody [NBP1-88100] - Staining of human fallopian tube shows weak to moderate positivity in apical membrane and cilia in glandular cells.")
![Immunohistochemistry-Paraffin: FLJ23834 Antibody [NBP1-88100] - Staining of human lymph node shows no positivity in non-germinal center cells as expected.](http://images.novusbio.com/fullsize/FLJ23834-Antibody-Immunohistochemistry-Paraffin-NBP1-88100-img0012.jpg "Immunohistochemistry-Paraffin: FLJ23834 Antibody [NBP1-88100] - Staining of human lymph node shows no positivity in non-germinal center cells as expected.")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")