FBXW9 Antibody - BSA Free

Western Blot: FBXW9 Antibody [NBP1-79823] - HepG2 Cell Lysate 1ug/ml Gel Concentration 12%

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

FBXW9 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptide directed towards the C terminal of human FBXW9The immunogen for this antibody is FBXW9. Peptide sequence PDILVTGTYDKKVTIYDPRAGPALLKHQQLHSRPVLTLLADDRHIISGSE. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FBXW9
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 51 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for FBXW9 Antibody - BSA Free

• F-box and WD repeat domain containing 9
• F-box and WD-40 domain protein 9
• F-box and WD-40 domain-containing protein 9
• F-box and WD-40 repeat containing protein 9
• specificity factor for SCF ubiquitin ligase

Background

FBXW9, also known as F-box/WD repeat-containing protein 9, has 3 isoforms, a 488 amino acid isoform that is 54 kDa, a 478 amino acid isoform that is 53 kDa and a 458 amino acid isoform that is 51 kDa; acts as a substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex. The protein is being studied for its involvement in neuronitis. FBXW9 has been shown to have interactions with SKP1, COPS6 and UBC in association of TriC/CCT with target proteins during biosynthesis, chaperonin-mediated protein folding, metabolism of proteins, and protein folding pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: FBXW9
• Uniprot:
  • NP_115677(Human)