FBXW9 Antibody

Images

 
Western Blot: FBXW9 Antibody [NBP1-79823] - HepG2 Cell Lysate 1ug/ml Gel Concentration 12%

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FBXW9 Antibody Summary

Immunogen
Synthetic peptide directed towards the C terminal of human FBXW9The immunogen for this antibody is FBXW9. Peptide sequence PDILVTGTYDKKVTIYDPRAGPALLKHQQLHSRPVLTLLADDRHIISGSE. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FBXW9
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against FBXW9 and was validated on Western blot.
Theoretical MW
51 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for FBXW9 Antibody

  • F-box and WD repeat domain containing 9
  • F-box and WD-40 domain protein 9
  • F-box and WD-40 domain-containing protein 9
  • F-box and WD-40 repeat containing protein 9
  • specificity factor for SCF ubiquitin ligase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for FBXW9 Antibody (NBP1-79823) (0)

There are no publications for FBXW9 Antibody (NBP1-79823).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FBXW9 Antibody (NBP1-79823) (0)

There are no reviews for FBXW9 Antibody (NBP1-79823). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FBXW9 Antibody (NBP1-79823) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FBXW9 Products

Bioinformatics Tool for FBXW9 Antibody (NBP1-79823)

Discover related pathways, diseases and genes to FBXW9 Antibody (NBP1-79823). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on FBXW9

There are no specific blogs for FBXW9, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FBXW9 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FBXW9
Uniprot