FBXO34 Antibody


Western Blot: FBXO34 Antibody [NBP1-68997] - Rat Brain lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity Mu, Rt, Hu, Bv, CaSpecies Glossary
Applications WB

Order Details

FBXO34 Antibody Summary

Synthetic peptides corresponding to Fbxo34 (F-box protein 34) The peptide sequence was selected from the N terminal of Fbxo34. Peptide sequence RDTLRTPMSHGKANGDVKARASYMKPTVLPSASLVKASSRKPFGILSPNV. The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Human (100%), Canine (93%), Bovine (100%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against Fbxo34 and was validated on Western blot.
Theoretical MW
82 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for FBXO34 Antibody

  • DKFZp547C162
  • F-box only protein 34
  • F-box protein 34
  • Fbx34
  • FLJ20725
  • MGC126434
  • MGC126435
  • protein CGI-301


The function of Fbxo34 remains unknown.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for FBXO34 Antibody (NBP1-68997) (0)

There are no publications for FBXO34 Antibody (NBP1-68997).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FBXO34 Antibody (NBP1-68997) (0)

There are no reviews for FBXO34 Antibody (NBP1-68997). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FBXO34 Antibody (NBP1-68997) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional FBXO34 Products

Bioinformatics Tool for FBXO34 Antibody (NBP1-68997)

Discover related pathways, diseases and genes to FBXO34 Antibody (NBP1-68997). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on FBXO34

There are no specific blogs for FBXO34, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our FBXO34 Antibody and receive a gift card or discount.


Gene Symbol FBXO34