Recombinant Human FBXL22 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human FBXL22 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 110 of Human FBXL22 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MHITQLNRECLLHLFSFLDKDSRKSLARTCSQLHDVFEDPALWSLLHFRSLTELQKDNFLLGPALRSLSICWHSSRVQVCSIEDWLKSAFQRSICSRHESLVNDFLLRVC

Protein/Peptide Type
Partial Recombinant Protein
Gene
FBXL22

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human FBXL22 Protein

  • Fbl22
  • F-box and leucine-rich repeat protein 22FLJ39626
  • F-box/LRR-repeat protein 22
  • MGC75496

Background

FBXL22 - F-box and leucine-rich repeat protein 22

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37539
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB120-1868
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P, IP
H00011026-M01
Species: Hu
Applications: WB, ELISA
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for FBXL22 Partial Recombinant Protein (H00283807-Q01) (0)

There are no publications for FBXL22 Partial Recombinant Protein (H00283807-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FBXL22 Partial Recombinant Protein (H00283807-Q01) (0)

There are no reviews for FBXL22 Partial Recombinant Protein (H00283807-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FBXL22 Partial Recombinant Protein (H00283807-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional FBXL22 Products

Bioinformatics Tool for FBXL22 Partial Recombinant Protein (H00283807-Q01)

Discover related pathways, diseases and genes to FBXL22 Partial Recombinant Protein (H00283807-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FBXL22 Partial Recombinant Protein (H00283807-Q01)

Discover more about diseases related to FBXL22 Partial Recombinant Protein (H00283807-Q01).

Blogs on FBXL22

There are no specific blogs for FBXL22, but you can read our latest blog posts.

Customers Who Bought This Also Bought

FBXL22 Antibody
NBP2-33724

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human FBXL22 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol FBXL22