Recombinant Human FBXL13 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human FBXL13 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 636 - 734 of Human FBXL13 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:ILDISGCVLLTDQILEDLQIGCKQLRILKMQYCTNISKKAAQRMSSKVQQQEYNTNDPPRWFGYDREGNPVTELDNITSSKGALELTVKKSTYSSEDQA

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
FBXL13

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human FBXL13 Protein

  • FBL13
  • F-box and leucine-rich repeat protein 13Fbl13
  • F-box/LRR-repeat protein 13
  • FLJ38068
  • MGC21636

Background

FBXL13 - F-box and leucine-rich repeat protein 13

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-80070
Species: Hu, Mu, Rt, Fu
Applications: WB, ICC/IF
NBP1-81127
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83309
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87048
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-1081
Species: Mu, Rt
Applications: WB, IHC, IHC-P
H00222235-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for FBXL13 Partial Recombinant Protein (H00222235-Q01) (0)

There are no publications for FBXL13 Partial Recombinant Protein (H00222235-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FBXL13 Partial Recombinant Protein (H00222235-Q01) (0)

There are no reviews for FBXL13 Partial Recombinant Protein (H00222235-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FBXL13 Partial Recombinant Protein (H00222235-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional FBXL13 Products

Bioinformatics Tool for FBXL13 Partial Recombinant Protein (H00222235-Q01)

Discover related pathways, diseases and genes to FBXL13 Partial Recombinant Protein (H00222235-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FBXL13 Partial Recombinant Protein (H00222235-Q01)

Discover more about diseases related to FBXL13 Partial Recombinant Protein (H00222235-Q01).

Blogs on FBXL13

There are no specific blogs for FBXL13, but you can read our latest blog posts.

Customers Who Bought This Also Bought

FBXL13 Antibody
NBP2-31664
NAPE-PLD Antibody
NB110-80070

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human FBXL13 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol FBXL13