![Immunocytochemistry/Immunofluorescence: FAR2 Antibody [NBP1-90435] - Staining of human cell line A-431 shows localization to nucleoli & the Golgi apparatus. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/FAR2-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-90435-img0006.jpg "Immunocytochemistry/Immunofluorescence: FAR2 Antibody [NBP1-90435] - Staining of human cell line A-431 shows localization to nucleoli & the Golgi apparatus. Antibody staining is shown in green.")
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: FLGKVLMEKLFRTSPDLKVIYILVRPKAGQTLQQRVFQILDSKLFEKVKEVCPNVHEKIRAIYADLNQNDFAISKEDMQELLSCTNIIFHCAATVRFDD |
| Predicted Species | Mouse (91%), Rat (90%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | FAR2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | FAR2 |
![Immunohistochemistry-Paraffin: FAR2 Antibody [NBP1-90435] - Staining of human cerebral cortes shows moderate granular cytoplasmic positivity in neurons.](http://images.novusbio.com/fullsize/FAR2-Antibody-Immunohistochemistry-Paraffin-NBP1-90435-img0010.jpg "Immunohistochemistry-Paraffin: FAR2 Antibody [NBP1-90435] - Staining of human cerebral cortes shows moderate granular cytoplasmic positivity in neurons.")
![Immunohistochemistry-Paraffin: FAR2 Antibody [NBP1-90435] - Staining of human rectum shows strong granular cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/FAR2-Antibody-Immunohistochemistry-Paraffin-NBP1-90435-img0007.jpg "Immunohistochemistry-Paraffin: FAR2 Antibody [NBP1-90435] - Staining of human rectum shows strong granular cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: FAR2 Antibody [NBP1-90435] - Staining of human renal cancer shows moderate granular cytoplasmic positivity in tumor cells.](http://images.novusbio.com/fullsize/FAR2-Antibody-Immunohistochemistry-Paraffin-NBP1-90435-img0008.jpg "Immunohistochemistry-Paraffin: FAR2 Antibody [NBP1-90435] - Staining of human renal cancer shows moderate granular cytoplasmic positivity in tumor cells.")
![Immunohistochemistry-Paraffin: FAR2 Antibody [NBP1-90435] - Staining of human placenta shows strong granular cytoplasmic positivity in trophoblastic cells.](http://images.novusbio.com/fullsize/FAR2-Antibody-Immunohistochemistry-Paraffin-NBP1-90435-img0009.jpg "Immunohistochemistry-Paraffin: FAR2 Antibody [NBP1-90435] - Staining of human placenta shows strong granular cytoplasmic positivity in trophoblastic cells.")
