FANCD2OS Antibody

Images

 
Western Blot: FANCD2OS Antibody [NBP1-98261] - Antibody Dilution: 1.0ug/ml Sample Tissue: Rat Pancreas.

Product Details

Summary
Reactivity Rt, Hu, Mu, Bv, Ca, Eq, Gp, RbSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FANCD2OS Antibody Summary

Immunogen
The immunogen for this antibody is RGD1565997 - N-terminal region. Peptide sequence LDESFQWLRHTTPTPSSKHPFRASPCFPHTPSDLEVQLCLQEVTLVLDSP. The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Human (100%), Mouse (100%), Bovine (100%), Guinea Pig (100%), Rabbit (100%), Canine (100%), Equine (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FANCD2OS
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for FANCD2OS Antibody

  • C3orf24
  • chromosome 3 open reading frame 24
  • fancd2 opposite strand
  • hypothetical protein LOC115795
  • RGD1565997

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for FANCD2OS Antibody (NBP1-98261) (0)

There are no publications for FANCD2OS Antibody (NBP1-98261).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FANCD2OS Antibody (NBP1-98261) (0)

There are no reviews for FANCD2OS Antibody (NBP1-98261). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FANCD2OS Antibody (NBP1-98261) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional FANCD2OS Products

Array NBP1-98261

Bioinformatics Tool for FANCD2OS Antibody (NBP1-98261)

Discover related pathways, diseases and genes to FANCD2OS Antibody (NBP1-98261). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on FANCD2OS

There are no specific blogs for FANCD2OS, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FANCD2OS Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FANCD2OS
Uniprot