FAM98B Antibody - BSA Free

Immunohistochemistry-Paraffin: FAM98B Antibody [NBP1-83475] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.

Western Blot: FAM98B Antibody [NBP1-83475] - Analysis using Anti-FAM98B antibody NBP1-83475 (A) shows similar pattern to independent antibody NBP1-83474 (B).

Immunohistochemistry-Paraffin: FAM98B Antibody [NBP1-83475] - Staining of human colon.

Immunohistochemistry-Paraffin: FAM98B Antibody [NBP1-83475] - Staining of human testis.

Immunohistochemistry-Paraffin: FAM98B Antibody [NBP1-83475] - Staining of human cerebral cortex shows strong nuclear positivity in neuronal cells.

Immunohistochemistry-Paraffin: FAM98B Antibody [NBP1-83475] - Staining of human cerebral cortex, gastrointestinal, skeletal muscle and testis using Anti-FAM98B antibody NBP1-83475 (A) shows similar protein distribution across tissues to independent antibody NBP1-83474 (B).

Immunohistochemistry-Paraffin: FAM98B Antibody [NBP1-83475] - Staining of human colon shows strong nuclear positivity in glandular cells.

Immunohistochemistry-Paraffin: FAM98B Antibody [NBP1-83475] - Staining of human parathyroid gland shows strong nuclear positivity in glandular cells.

Immunohistochemistry-Paraffin: FAM98B Antibody [NBP1-83475] - Staining of human skeletal muscle shows strong nuclear positivity in myocytes.

Western Blot: FAM98B Antibody [NBP1-83475] - RTCB is required for induction of XBP1s during plasma cell differentiationB220+ splenocytes of control (Rtcbfl/fl or Rtcbfl/+), Rtcbfl/+Cd23-Cre or Rtcbfl/flCd23-Cre mice were stimulated with 20 μg/ml LPS for 4 days.A, B Protein levels of RTCB, tRNA ligase complex members (DDX1, FAM98B, CGI-99) & XBP1 were monitored by Western blot analysis (n > 3).C FACS-sorted CD138+ CD22− plasmablasts or CD138− CD22low pre-plasmablasts were probed for expression of the indicated proteins by Western blot analysis (n = 2).D Relative mRNA levels of Rtcb, Xbp1s, total Xbp1, Edem1, μM & μS were analyzed by RT–qPCR in fractionated LPS-stimulated cells at day 4 (n = 4, mean expression levels & SEM are displayed). Expression levels were normalized to Actb mRNA levels & to B cells from control mice. An unpaired Student's t-test was used to analyze the statistical significance of differences in mRNA levels (*P < 0.05, **P < 0.01, ***P < 0.001, ****P < 0.0001). Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/25378478), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

• Reactivity: Hu, Mu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

FAM98B Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: STTSDIPHMLNQVESKVKDILSKVQKNHVGKPLLKMDLNSEQAEQLERINDALSCEYECRRRMLMKRLDVTVQSFGWSDRAKVKTDDIARIYQPKRYALSPKTTITMAHLLAAREDLSKIIRTSSGTSREKTACAI
• Predicted Species: Mouse (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FAM98B
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry-Paraffin 1:20-1:50
  • Western Blot 1:100-1:500
• Application Notes: WB reported in scientific literature (PMID: 25378478). For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  FAM98B Protein (NBP1-83475PEP)

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24608264)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for FAM98B Antibody - BSA Free

• family with sequence similarity 98, member B
• FLJ38426

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for FAM98B Antibody (NBP1-83475)(3)

Publications using NBP1-83475

• Jurkin J, Henkel T, Nielsen AF et al. The mammalian tRNA ligase complex mediates splicing of XBP1 mRNA and controls antibody secretion in plasma cells. EMBO J 2014-12-17 [PMID: 25378478] (WB, Human)
• Popow J, Jurkin J, Schleiffer A et al. Analysis of orthologous groups reveals Archease and DDX1 as tRNA splicing factors. Nature 2014-07-03 [PMID: 24870230]
• Perez-Gonzalez A, Pazo A, Navajas R et al. hCLE/C14orf166 Associates with DDX1-HSPC117-FAM98B in a Novel Transcription-Dependent Shuttling RNA-Transporting Complex. PLoS One 2014-01-01 [PMID: 24608264]

Bioinformatics

• Gene Symbol: FAM98B