FAM90A1 Antibody

Images

 
Western Blot: FAM90A1 Antibody [NBP1-56875] - Jurkat cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FAM90A1 Antibody Summary

Immunogen
Synthetic peptides corresponding to FAM90A1(family with sequence similarity 90, member A1) The peptide sequence was selected from the N terminal of FAM90A1. Peptide sequence PDEEDPRLKCKNCEAFGHTARSTRCPMKCWKAALVPPNFGEKEGKENLKP.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FAM90A1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against FAM90A1 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for FAM90A1 Antibody

  • family with sequence similarity 90, member A1
  • FLJ10408
  • hypothetical protein LOC55138

Background

FAM90A1 belongs to subfamily I of the primate-specific FAM90A gene family, which originated from multiple duplications and rearrangements (Bosch et al., 2007 [PubMed 17684299]).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for FAM90A1 Antibody (NBP1-56875) (0)

There are no publications for FAM90A1 Antibody (NBP1-56875).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FAM90A1 Antibody (NBP1-56875) (0)

There are no reviews for FAM90A1 Antibody (NBP1-56875). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FAM90A1 Antibody (NBP1-56875) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FAM90A1 Products

Bioinformatics Tool for FAM90A1 Antibody (NBP1-56875)

Discover related pathways, diseases and genes to FAM90A1 Antibody (NBP1-56875). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on FAM90A1

There are no specific blogs for FAM90A1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FAM90A1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FAM90A1
Uniprot