FAM54A Antibody

Images

 
Western Blot: FAM54A Antibody [NBP2-87422] - WB Suggested Anti-FAM54A Antibody. Titration: 1.0 ug/ml. Positive Control: 721_B Whole Cell

Product Details

Summary
Reactivity Hu, EqSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FAM54A Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of FAM54A. Peptide sequence: ENRSWESSPFSSPETSRFGHHISQSEGQRTKEEMVNTKAVDQGISNTSLL The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Equine (100%). Backed by our 100% Guarantee.
Clonality
Polyclonal
Host
Rabbit
Gene
MTFR2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FAM54A Antibody

  • DUF729 domain containing 1
  • DUF729 domain-containing protein 1
  • DUFD1
  • family with sequence similarity 54, member A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84480
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-87422
Species: Hu, Eq
Applications: WB

Publications for FAM54A Antibody (NBP2-87422) (0)

There are no publications for FAM54A Antibody (NBP2-87422).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FAM54A Antibody (NBP2-87422) (0)

There are no reviews for FAM54A Antibody (NBP2-87422). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FAM54A Antibody (NBP2-87422) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional FAM54A Products

Bioinformatics Tool for FAM54A Antibody (NBP2-87422)

Discover related pathways, diseases and genes to FAM54A Antibody (NBP2-87422). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on FAM54A

There are no specific blogs for FAM54A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FAM54A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MTFR2