FAM217A Antibody

Images

 
Western Blot: FAM217A Antibody [NBP1-91462] - Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate.

Product Details

Summary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FAM217A Antibody Summary

Immunogen
Synthetic peptide directed towards the middle region of human C6orf146. Peptide sequence ETLPAPNWNLKHGNSSVEENFTDESDLSENEKTNDTLLSYFKKVDLNLKP. The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Mouse (92%), Rabbit (93%), Bovine (93%), Canine (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FAM217A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against C6orf146 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for FAM217A Antibody

  • C6orf146
  • chromosome 6 open reading frame 146
  • family with sequence similarity 217, member A
  • hypothetical protein LOC222826

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for FAM217A Antibody (NBP1-91462) (0)

There are no publications for FAM217A Antibody (NBP1-91462).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FAM217A Antibody (NBP1-91462) (0)

There are no reviews for FAM217A Antibody (NBP1-91462). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FAM217A Antibody (NBP1-91462) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional FAM217A Products

Bioinformatics Tool for FAM217A Antibody (NBP1-91462)

Discover related pathways, diseases and genes to FAM217A Antibody (NBP1-91462). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on FAM217A

There are no specific blogs for FAM217A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FAM217A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FAM217A
Uniprot