FAM160B1 Antibody

Images

 
Western Blot: FAM160B1 Antibody [NBP1-57822] - Jurkat cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity Hu, Mu, Rt, Bv, Ca, Eq, Gp, Rb, ZeSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FAM160B1 Antibody Summary

Immunogen
Synthetic peptides corresponding to FAM160B1 (family with sequence similarity 160, member B1) Antibody(against the N terminal of FAM160B1. Peptide sequence HYYIETSDDKAPVTDTNIPSHLEQMLDILVQEENERESGETGPCMEYLLH. The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Mouse (100%), Rat (100%), Canine (100%), Equine (100%), Zebrafish (100%), Rabbit (100%), Bovine (100%), Guinea Pig (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FAM160B1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against KIAA1600 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for FAM160B1 Antibody

  • DKFZp686D10123
  • family with sequence similarity 160, member B1
  • hypothetical protein LOC57700
  • KIAA1600bA106M7.3

Background

The function of this protein remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for FAM160B1 Antibody (NBP1-57822) (0)

There are no publications for FAM160B1 Antibody (NBP1-57822).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FAM160B1 Antibody (NBP1-57822) (0)

There are no reviews for FAM160B1 Antibody (NBP1-57822). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FAM160B1 Antibody (NBP1-57822) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional FAM160B1 Products

Bioinformatics Tool for FAM160B1 Antibody (NBP1-57822)

Discover related pathways, diseases and genes to FAM160B1 Antibody (NBP1-57822). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on FAM160B1

There are no specific blogs for FAM160B1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FAM160B1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FAM160B1
Uniprot