FAM113A Antibody

Images

 
Western Blot: FAM113A Antibody [NBP1-55521] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity Hu, Mu, Rt, Ca, Eq, Gp, RbSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FAM113A Antibody Summary

Immunogen
Synthetic peptides corresponding to FAM113A(family with sequence similarity 113, member A) The peptide sequence was selected from the N terminal of FAM113A. Peptide sequence VLLLQKDSLLTAAQLKAKGELSFEQDQLVAGGQLGELHNGTQYREVRQFC. The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Mouse (100%), Rat (100%), Canine (100%), Equine (100%), Guinea Pig (100%), Rabbit (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PCED1A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against FAM113A and was validated on Western blot.
Theoretical MW
52 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for FAM113A Antibody

  • bA12M19.1
  • C20orf81
  • chromosome 20 open reading frame 81
  • DKFZp547L054
  • family with sequence similarity 113, member A
  • FLJ22376
  • hypothetical protein LOC64773
  • Sarcoma antigen NY-SAR-23

Background

The function remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for FAM113A Antibody (NBP1-55521) (0)

There are no publications for FAM113A Antibody (NBP1-55521).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FAM113A Antibody (NBP1-55521) (0)

There are no reviews for FAM113A Antibody (NBP1-55521). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FAM113A Antibody (NBP1-55521) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional FAM113A Products

Bioinformatics Tool for FAM113A Antibody (NBP1-55521)

Discover related pathways, diseases and genes to FAM113A Antibody (NBP1-55521). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on FAM113A

There are no specific blogs for FAM113A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FAM113A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PCED1A
Uniprot