Recombinant Human FAHD2A GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human FAHD2A GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-314 of Human FAHD2A full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MLVSGRRRLLTVLLQAQKWPFQPSRDMRLVQFRAPHLVGPHLGLETGNGGGVINLNAFDPTLPKTMTQFLEQGEATLSVARRALAAQLPVLPRSEVTFLAPVTRPDKVVCVGMNYVDHCKEQNVPVPKEPIIFSKFASSIVGPYDEVVLPPQSQEVDWEVELAVVIGKKGKHIKATDAMAHVAGFTVAHDVSARDWQMRRNGKQWLLGKTFDTFCPLGPALVTKDSVADPHNLKICCRVNGEVVQSGNTNQMVFKTEDLIAWVSQFVTFYPGDVILTGTPPGVGVFRKPPVFLKKGDEVQCEIEELGVIINKVV

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
FAHD2A
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
61 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human FAHD2A GST (N-Term) Protein

  • CGI-105
  • EC 3.-
  • fumarylacetoacetate hydrolase domain containing 1
  • fumarylacetoacetate hydrolase domain containing 2A
  • fumarylacetoacetate hydrolase domain-containing protein 2A
  • MGC131995

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-48736
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-48736
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-03286
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB100-77417
Species: Mu, Rt
Applications: WB, Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, In vivo, CyTOF-ready
NBP2-43666
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for FAHD2A Recombinant Protein (H00051011-P01) (0)

There are no publications for FAHD2A Recombinant Protein (H00051011-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FAHD2A Recombinant Protein (H00051011-P01) (0)

There are no reviews for FAHD2A Recombinant Protein (H00051011-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FAHD2A Recombinant Protein (H00051011-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional FAHD2A Products

Bioinformatics Tool for FAHD2A Recombinant Protein (H00051011-P01)

Discover related pathways, diseases and genes to FAHD2A Recombinant Protein (H00051011-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FAHD2A Recombinant Protein (H00051011-P01)

Discover more about diseases related to FAHD2A Recombinant Protein (H00051011-P01).
 

Pathways for FAHD2A Recombinant Protein (H00051011-P01)

View related products by pathway.

Research Areas for FAHD2A Recombinant Protein (H00051011-P01)

Find related products by research area.

Blogs on FAHD2A

There are no specific blogs for FAHD2A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human FAHD2A GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol FAHD2A