ETV3L Antibody

Images

 
Western Blot: ETV3L Antibody [NBP1-79214] - Jurkat cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ETV3L Antibody Summary

Immunogen
Synthetic peptide directed towards the C terminal of human ETV3LThe immunogen for this antibody is ETV3L. Peptide sequence LPPLPSEQQLPGAFKPDILLPGPRSLPGAWHFPGLPLLAGLGQGAGERLW.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ETV3L
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against ETV3L and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ETV3L Antibody

  • ets variant 3-like
  • ets variant gene 3-like

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ETV3L Antibody (NBP1-79214) (0)

There are no publications for ETV3L Antibody (NBP1-79214).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ETV3L Antibody (NBP1-79214) (0)

There are no reviews for ETV3L Antibody (NBP1-79214). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ETV3L Antibody (NBP1-79214) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ETV3L Products

Array NBP1-79214

Bioinformatics Tool for ETV3L Antibody (NBP1-79214)

Discover related pathways, diseases and genes to ETV3L Antibody (NBP1-79214). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on ETV3L

There are no specific blogs for ETV3L, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ETV3L Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ETV3L
Uniprot