EPHX4 Antibody

Immunocytochemistry/Immunofluorescence: EPHX4 Antibody [NBP1-89307] - Staining of human cell line U-2 OS shows localization to vesicles. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: EPHX4 Antibody [NBP1-89307] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Immunohistochemistry-Paraffin: EPHX4 Antibody [NBP1-89307] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.

Immunohistochemistry-Paraffin: EPHX4 Antibody [NBP1-89307] - Staining of human fallopian tube shows moderate membranous positivity in glandular cells.

Immunohistochemistry-Paraffin: EPHX4 Antibody [NBP1-89307] - Staining of human gastrointestinal shows moderate membranous positivity in glandular cells.

• Reactivity: Hu
• Applications: ICC/IF, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

EPHX4 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: FPHPNVFTEYILRHPAQLLKSSYYYFFQIPWFPEFMFSINDFKVLKHLFTSHSTGIGRKGCQLTTEDLEAYIYVF
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: EPHX4
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  EPHX4 Protein (NBP1-89307PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%), Rat (85%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for EPHX4 Antibody

• ABHD7
• abhydrolase domain containing 7
• Abhydrolase domain-containing protein 7
• EC 3.3
• EPHXRPEpoxide hydrolase-related protein
• epoxide hydrolase 4
• FLJ90341

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for EPHX4 Antibody (NBP1-89307)(1)

Publication using NBP1-89307

• Dahlhoff M, Frohlich T, Arnold GJ et al. Characterization of the sebocyte lipid droplet proteome reveals novel potential regulators of sebaceous lipogenesis. Exp. Cell Res. 2014-12-16 [PMID: 25523620] (ICC/IF, IHC-P, Human)

Bioinformatics

• Gene Symbol: EPHX4