EPHX4 Antibody


Immunocytochemistry/ Immunofluorescence: EPHX4 Antibody [NBP1-89307] - Staining of human cell line U-2 OS shows localization to vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: EPHX4 Antibody [NBP1-89307] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: EPHX4 Antibody [NBP1-89307] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: EPHX4 Antibody [NBP1-89307] - Staining of human fallopian tube shows moderate membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: EPHX4 Antibody [NBP1-89307] - Staining of human gastrointestinal shows moderate membranous positivity in glandular cells.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF, IHC

Order Details

EPHX4 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: FPHPNVFTEYILRHPAQLLKSSYYYFFQIPWFPEFMFSINDFKVLKHLFTSHSTGIGRKGCQLTTEDLEAYIYVF
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
EPHX4 Protein (NBP1-89307PEP)
Read Publication using
NBP1-89307 in the following applications:

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%), Rat (85%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for EPHX4 Antibody

  • ABHD7
  • abhydrolase domain containing 7
  • Abhydrolase domain-containing protein 7
  • EC 3.3
  • EPHXRPEpoxide hydrolase-related protein
  • epoxide hydrolase 4
  • FLJ90341


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for EPHX4 Antibody (NBP1-89307)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: ICC/IF, IHC-P.

Filter By Application
All Applications
Filter By Species
All Species

Reviews for EPHX4 Antibody (NBP1-89307) (0)

There are no reviews for EPHX4 Antibody (NBP1-89307). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for EPHX4 Antibody (NBP1-89307) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional EPHX4 Products

Research Areas for EPHX4 Antibody (NBP1-89307)

Find related products by research area.

Blogs on EPHX4

There are no specific blogs for EPHX4, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our EPHX4 Antibody and receive a gift card or discount.


Gene Symbol EPHX4