![Immunocytochemistry/Immunofluorescence: EPHX4 Antibody [NBP1-89307] - Staining of human cell line U-2 OS shows localization to vesicles. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/EPHX4-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-89307-img0006.jpg "Immunocytochemistry/Immunofluorescence: EPHX4 Antibody [NBP1-89307] - Staining of human cell line U-2 OS shows localization to vesicles. Antibody staining is shown in green.")
| Reactivity | HuSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit EPHX4 Antibody - BSA Free (NBP1-89307) is a polyclonal antibody validated for use in IHC and ICC/IF. Anti-EPHX4 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: FPHPNVFTEYILRHPAQLLKSSYYYFFQIPWFPEFMFSINDFKVLKHLFTSHSTGIGRKGCQLTTEDLEAYIYVF |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | EPHX4 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
| Publication using NBP1-89307 | Applications | Species |
|---|---|---|
| Dahlhoff M, Frohlich T, Arnold GJ et al. Characterization of the sebocyte lipid droplet proteome reveals novel potential regulators of sebaceous lipogenesis. Exp. Cell Res. 2014-12-16 [PMID: 25523620] (ICC/IF, IHC-P, Human) | ICC/IF, IHC-P | Human |
Secondary Antibodies |
Isotype Controls |
Research Areas for EPHX4 Antibody (NBP1-89307)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | EPHX4 |
![Immunohistochemistry-Paraffin: EPHX4 Antibody [NBP1-89307] - Staining of human skeletal muscle shows no positivity in myocytes as expected.](http://images.novusbio.com/fullsize/EPHX4-Antibody-Immunohistochemistry-Paraffin-NBP1-89307-img0011.jpg "Immunohistochemistry-Paraffin: EPHX4 Antibody [NBP1-89307] - Staining of human skeletal muscle shows no positivity in myocytes as expected.")
![Immunohistochemistry-Paraffin: EPHX4 Antibody [NBP1-89307] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.](http://images.novusbio.com/fullsize/EPHX4-Antibody-Immunohistochemistry-Paraffin-NBP1-89307-img0008.jpg "Immunohistochemistry-Paraffin: EPHX4 Antibody [NBP1-89307] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.")
![Immunohistochemistry-Paraffin: EPHX4 Antibody [NBP1-89307] - Staining of human fallopian tube shows moderate membranous positivity in glandular cells.](http://images.novusbio.com/fullsize/EPHX4-Antibody-Immunohistochemistry-Paraffin-NBP1-89307-img0009.jpg "Immunohistochemistry-Paraffin: EPHX4 Antibody [NBP1-89307] - Staining of human fallopian tube shows moderate membranous positivity in glandular cells.")
![Immunohistochemistry-Paraffin: EPHX4 Antibody [NBP1-89307] - Staining of human gastrointestinal shows moderate membranous positivity in glandular cells.](http://images.novusbio.com/fullsize/EPHX4-Antibody-Immunohistochemistry-Paraffin-NBP1-89307-img0010.jpg "Immunohistochemistry-Paraffin: EPHX4 Antibody [NBP1-89307] - Staining of human gastrointestinal shows moderate membranous positivity in glandular cells.")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")