EPHX4 Antibody

Images

 
Western Blot: EPHX4 Antibody [NBP1-89307] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-186
Immunocytochemistry/ Immunofluorescence: EPHX4 Antibody [NBP1-89307] - Staining of human cell line U-2 OS shows positivity in vesicles.
Immunohistochemistry-Paraffin: EPHX4 Antibody [NBP1-89307] - Staining of human gall bladder shows strong membranous and cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

EPHX4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:FPHPNVFTEYILRHPAQLLKSSYYYFFQIPWFPEFMFSINDFKVLKHLFTSHSTGIGRKGCQLTTEDLEAYIYVF
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
EPHX4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin HIER pH6 retrieval is recommended.
Control Peptide
EPHX4 Protein (NBP1-89307PEP)
Publications
Read Publication using
NBP1-89307 in the following applications:

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (88%), Rat (85%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for EPHX4 Antibody

  • ABHD7
  • abhydrolase domain containing 7
  • Abhydrolase domain-containing protein 7
  • EC 3.3
  • EPHXRPEpoxide hydrolase-related protein
  • epoxide hydrolase 4
  • FLJ90341

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for EPHX4 Antibody (NBP1-89307)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: ICC/IF, IHC-P.


Filter By Application
ICC/IF
(1)
IHC-P
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for EPHX4 Antibody (NBP1-89307) (0)

There are no reviews for EPHX4 Antibody (NBP1-89307). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for EPHX4 Antibody (NBP1-89307) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional EPHX4 Antibody Products

Bioinformatics Tool for EPHX4 Antibody (NBP1-89307)

Discover related pathways, diseases and genes to EPHX4 Antibody (NBP1-89307). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for EPHX4 Antibody (NBP1-89307)

Find related products by research area.

Blogs on EPHX4

There are no specific blogs for EPHX4, but you can read our latest blog posts.

Contact Information

Product PDFs

Review this Product

Be the first to review our EPHX4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EPHX4

Customers Who Bought This Also Bought