EPHX4 Antibody


Immunocytochemistry/ Immunofluorescence: EPHX4 Antibody [NBP1-89307] - Immunofluorescent staining of human cell line U-2 OS shows localization to vesicles.
Immunohistochemistry-Paraffin: EPHX4 Antibody [NBP1-89307] - Staining of human gall bladder shows strong membranous and cytoplasmic positivity in glandular cells.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

EPHX4 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: FPHPNVFTEYILRHPAQLLKSSYYYFFQIPWFPEFMFSINDFKVLKHLFTSHSTGIGRKGCQLTTEDLEAYIYVF
Specificity of human EPHX4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
EPHX4 Protein (NBP1-89307PEP)
Read Publication using
NBP1-89307 in the following applications:

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (88%), Rat (85%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for EPHX4 Antibody

  • ABHD7
  • abhydrolase domain containing 7
  • Abhydrolase domain-containing protein 7
  • EC 3.3
  • EPHXRPEpoxide hydrolase-related protein
  • epoxide hydrolase 4
  • FLJ90341


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for EPHX4 Antibody (NBP1-89307)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: ICC/IF, IHC-P.

Filter By Application
All Applications
Filter By Species
All Species

Reviews for EPHX4 Antibody (NBP1-89307) (0)

There are no reviews for EPHX4 Antibody (NBP1-89307). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for EPHX4 Antibody (NBP1-89307) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional EPHX4 Products

Bioinformatics Tool for EPHX4 Antibody (NBP1-89307)

Discover related pathways, diseases and genes to EPHX4 Antibody (NBP1-89307). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for EPHX4 Antibody (NBP1-89307)

Find related products by research area.

Blogs on EPHX4

There are no specific blogs for EPHX4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our EPHX4 Antibody and receive a gift card or discount.


Gene Symbol EPHX4