DUX4 Antibody - BSA Free

Images

 
Western Blot: DUX4 Antibody [NBP3-10611] - Western blot analysis of DUX4 in THP-1 Whole cell lysates. Antibody dilution at 1.0ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free
Concentration
0.5 mg/ml

Order Details

DUX4 Antibody - BSA Free Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human DUX4 (NP_001280727.1). Peptide sequence ESRPWPGRRGPPEGRRKRTAVTGSQTALLLRAFEKDRFPGIAAREELARE
Clonality
Polyclonal
Host
Rabbit
Gene
DUX4
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Theoretical MW
46 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Purity
Affinity purified

Alternate Names for DUX4 Antibody - BSA Free

  • double homeobox 4
  • double homeobox protein 10
  • double homeobox protein 4
  • double homeobox protein 4/10
  • double homeobox protein DUX10
  • DUX10
  • DUX4
  • DUX4L1

Background

The DUX4 gene is located within a D4Z4 repeat array in the subtelomeric region of chromosome 4q. The D4Z4 repeat is polymorphic in length; a similar D4Z4 repeat array has been identified on chromosome 10. DUX4 (also known as Double homeobox 4) is the leading candidate causative gene for facioscapulohumeral dystrophy (FSHD), a degenerative skeletal muscle disease and one of the most common muscular dystrophies. FSHD is caused by the deletion of a subset of D4Z4 macrosatellite repeats on chromosome 4. Each repeat contains a retrogene encoding the double-homeobox factor DUX4. DUX4 expression is epigenetically suppressed in differentiated tissues and the residual DUX4 transcripts are spliced to remove the carboxyterminal domain that has been associated with cell toxicity. In FSHD individuals, the expression of the full-length DUX4 transcript is not completely suppressed in skeletal muscle, and possibly other differentiated tissues, and results in a small percentage of cells expressing relatively abundant amounts of the full-length DUX4 mRNA and protein. [Snider et al. (2010) PLoS Genetics.6(10): e1001181]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for DUX4 Antibody (NBP3-10611) (0)

There are no publications for DUX4 Antibody (NBP3-10611).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DUX4 Antibody (NBP3-10611) (0)

There are no reviews for DUX4 Antibody (NBP3-10611). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DUX4 Antibody (NBP3-10611) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DUX4 Products

Array NBP3-10611

Research Areas for DUX4 Antibody (NBP3-10611)

Find related products by research area.

Blogs on DUX4

There are no specific blogs for DUX4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DUX4 Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol DUX4