DPY19L2 Antibody

Western Blot: DPY19L2 Antibody [NBP1-69236] - This Anti-DPY19L2 antibody was used in Western Blot of Fetal Heart tissue lysate at a concentration of 1ug/ml.

Product Discontinued

DPY19L2 Antibody Summary

• Immunogen: Synthetic peptides corresponding to DPY19L2(dpy-19-like 2 (C. elegans)) The peptide sequence was selected from the middle region of DPY19L2. Peptide sequence IIGEFNNLPQEELLQWIKYSTTSDAVFAGAMPTMASIKLSTLHPIVNHPH. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DPY19L2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Application Notes: This is a rabbit polyclonal antibody against DPY19L2 and was validated on Western blot.
• Theoretical MW: 87 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for DPY19L2 Antibody

• dpy-19-like 2 (C. elegans)
• Dpy-19-like protein 2
• FLJ32949
• FLJ36166
• protein dpy-19 homolog 2

Background

The exact functions of DPY19L2 remain unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DPY19L2
• Uniprot:
  • Q6NUT2(Human)