DPY19L2 Antibody

Images

 
Western Blot: DPY19L2 Antibody [NBP1-69236] - This Anti-DPY19L2 antibody was used in Western Blot of Fetal Heart tissue lysate at a concentration of 1ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DPY19L2 Antibody Summary

Immunogen
Synthetic peptides corresponding to DPY19L2(dpy-19-like 2 (C. elegans)) The peptide sequence was selected from the middle region of DPY19L2. Peptide sequence IIGEFNNLPQEELLQWIKYSTTSDAVFAGAMPTMASIKLSTLHPIVNHPH.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DPY19L2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against DPY19L2 and was validated on Western blot.
Theoretical MW
87 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for DPY19L2 Antibody

  • dpy-19-like 2 (C. elegans)
  • Dpy-19-like protein 2
  • FLJ32949
  • FLJ36166
  • protein dpy-19 homolog 2

Background

The exact functions of DPY19L2 remain unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13368
Species: Hu
Applications: WB, IHC, IHC-P
NB120-3420
Species: Mu, Rt
Applications: WB, ICC/IF, IP, ICC, IF
NBP2-52532
Species: Hu, Rt, Mk
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
MAB25031
Species: Hu
Applications: WB, IHC, IP
NBP1-86489
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00554236-P01
Species: Hu
MAB2005
Species: Hu
Applications: WB, Flow, CyTOF-ready
H00089869-R01
Species: Hu
NB100-534
Species: Hu
Applications: WB, IP
NBP1-69236
Species: Hu
Applications: WB

Publications for DPY19L2 Antibody (NBP1-69236) (0)

There are no publications for DPY19L2 Antibody (NBP1-69236).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DPY19L2 Antibody (NBP1-69236) (0)

There are no reviews for DPY19L2 Antibody (NBP1-69236). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DPY19L2 Antibody (NBP1-69236) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DPY19L2 Products

Bioinformatics Tool for DPY19L2 Antibody (NBP1-69236)

Discover related pathways, diseases and genes to DPY19L2 Antibody (NBP1-69236). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DPY19L2 Antibody (NBP1-69236)

Discover more about diseases related to DPY19L2 Antibody (NBP1-69236).
 

Pathways for DPY19L2 Antibody (NBP1-69236)

View related products by pathway.

Blogs on DPY19L2

There are no specific blogs for DPY19L2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DPY19L2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DPY19L2
Uniprot