![Immunocytochemistry/Immunofluorescence: DCUN1D5 Antibody [NBP2-30432] - Immunofluorescent staining of human cell line HEK 293 shows localization to nucleus & nucleoli.](http://images.novusbio.com/fullsize/DCUN1D5-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-30432-img0005.jpg "Immunocytochemistry/Immunofluorescence: DCUN1D5 Antibody [NBP2-30432] - Immunofluorescent staining of human cell line HEK 293 shows localization to nucleus & nucleoli.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | Simple Western, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: MPVKKKRKSPGVAAAVAEDGGLKKCKISSYCRSQPPARLISGEEHFSSKKCLAWF |
| Predicted Species | Mouse (91%), Rat (93%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | DCUN1D5 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. See Simple Western Antibody Database for Simple Western validation. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry: DCUN1D5 Antibody [NBP2-30432] - Staining of human bone marrow shows strong nuclear positivity in hematopoietic cells.](http://images.novusbio.com/fullsize/DCUN1D5-Antibody-Immunohistochemistry-NBP2-30432-img0001.jpg "Immunohistochemistry: DCUN1D5 Antibody [NBP2-30432] - Staining of human bone marrow shows strong nuclear positivity in hematopoietic cells.")
![Simple Western: DCUN1D5 Antibody [NBP2-30432] - Simple Western lane view shows a specific band for DCUN1D5 in 0.2 mg/ml of SW480 lysate(s). This experiment was performed under reducing conditions using the 12-230 kDa separation systems.](http://images.novusbio.com/fullsize/DCUN1D5-Antibody-Simple-Western-NBP2-30432-img0003.jpg "Simple Western: DCUN1D5 Antibody [NBP2-30432] - Simple Western lane view shows a specific band for DCUN1D5 in 0.2 mg/ml of SW480 lysate(s). This experiment was performed under reducing conditions using the 12-230 kDa separation systems.")
![Simple Western: DCUN1D5 Antibody [NBP2-30432] - Electropherogram image of the corresponding Simple Western lane view. DCUN1D5 antibody was used at 1:10 dilution on SW480 lysate(s) respectively.](http://images.novusbio.com/fullsize/DCUN1D5-Antibody-Simple-Western-NBP2-30432-img0004.jpg "Simple Western: DCUN1D5 Antibody [NBP2-30432] - Electropherogram image of the corresponding Simple Western lane view. DCUN1D5 antibody was used at 1:10 dilution on SW480 lysate(s) respectively.")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")