DCUN1D5 Antibody


Western Blot: DCUN1D5 Antibody [NBP2-30432] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: CACO-2
Immunocytochemistry/ Immunofluorescence: DCUN1D5 Antibody [NBP2-30432] - Immunofluorescent staining of human cell line HEK 293 shows localization to nucleus & nucleoli.
Immunohistochemistry: DCUN1D5 Antibody [NBP2-30432] - Staining of human bone marrow shows strong nuclear positivity in hematopoietic cells.
Simple Western: DCUN1D5 Antibody [NBP2-30432] - Simple Western lane view shows a specific band for DCUN1D5 in 0.2 mg/ml of SW480 lysate(s). This experiment was performed under reducing conditions using the 12-230 kDa ...read more
Simple Western: DCUN1D5 Antibody [NBP2-30432] - Electropherogram image of the corresponding Simple Western lane view. DCUN1D5 antibody was used at 1:10 dilution on SW480 lysate(s) respectively.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, Simple Western, ICC/IF, IHC, IHC-P

Order Details

DCUN1D5 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: MPVKKKRKSPGVAAAVAEDGGLKKCKISSYCRSQPPARLISGEEHFSSKKCLAWF
Specificity of human DCUN1D5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%), Rat (93%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Simple Western 1:10
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
DCUN1D5 Protein (NBP2-30432PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for DCUN1D5 Antibody

  • DCN1, defective in cullin neddylation 1, domain containing 5 (S. cerevisiae)
  • DCN1-like protein 5
  • DCUN1 domain-containing protein 5
  • Defective in cullin neddylation protein 1-like protein 5
  • FLJ32431
  • FLJ37425
  • MGC2714


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for DCUN1D5 Antibody (NBP2-30432) (0)

There are no publications for DCUN1D5 Antibody (NBP2-30432).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DCUN1D5 Antibody (NBP2-30432) (0)

There are no reviews for DCUN1D5 Antibody (NBP2-30432). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for DCUN1D5 Antibody (NBP2-30432) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional DCUN1D5 Products

Bioinformatics Tool for DCUN1D5 Antibody (NBP2-30432)

Discover related pathways, diseases and genes to DCUN1D5 Antibody (NBP2-30432). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DCUN1D5 Antibody (NBP2-30432)

Discover more about diseases related to DCUN1D5 Antibody (NBP2-30432).

Pathways for DCUN1D5 Antibody (NBP2-30432)

View related products by pathway.

Blogs on DCUN1D5

There are no specific blogs for DCUN1D5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our DCUN1D5 Antibody and receive a gift card or discount.


Gene Symbol DCUN1D5