![Western Blot: CXorf56/MRX107 Antibody [NBP3-10720] - Western blot analysis of CXorf56/MRX107 in Rat Lung lysates. Antibody dilution at 1.0ug/ml](http://images.novusbio.com/fullsize2/CXorf56-MRX107-Antibody-Western-Blot-NBP3-10720-img0001.jpg "Western Blot: CXorf56/MRX107 Antibody [NBP3-10720] - Western blot analysis of CXorf56/MRX107 in Rat Lung lysates. Antibody dilution at 1.0ug/ml")
| Reactivity | RtSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Rat CXorf56/MRX107 (NP_001101420). Peptide sequence GAVVKFGQGFGKTNIYTQKQEPPKKVMMTKRTKDMGKFSSVTVSTIDEEE |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | STEEP1, CXORF56 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Theoretical MW | 24 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS buffer, 2% sucrose. |
| Preservative | 0.09% Sodium Azide |
| Purity | Affinity purified |
![Immunocytochemistry/Immunofluorescence: Adenine Nucleotide Translocator 2 Antibody [NBP2-92630] - Analysis of HeLa cells using Adenine Nucleotide Translocator 2 . Blue: DAPI for nuclear staining.](http://images.novusbio.com/images2/Adenine-Nucleotide-Translocator-2-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-92630-img0001.jpg)
![Immunohistochemistry-Paraffin: Adenine Nucleotide Translocator 2 Antibody [NBP2-92630] - Paraffin-embedded mouse heart using Adenine Nucleotide Translocator 2 .](http://images.novusbio.com/images2/Adenine-Nucleotide-Translocator-2-Antibody-Immunohistochemistry-Paraffin-NBP2-92630-img0002.jpg)
![Western Blot: Adenine Nucleotide Translocator 2 Antibody [NBP2-92630] - Analysis of extracts of various cell lines, using Adenine Nucleotide Translocator 2 at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit . Exposure time: 60s.](http://images.novusbio.com/images2/Adenine-Nucleotide-Translocator-2-Antibody-Western-Blot-NBP2-92630-img0004.jpg)
![Western Blot: NKRF Antibody [NBP3-10499] - Western blot analysis using NBP3-10499 on Human Muscle as a positive control. Antibody Titration: 0.2-1 ug/ml](http://images.novusbio.com/images2/NKRF-Antibody-Western-Blot-NBP3-10499-img0001.jpg)
![Immunocytochemistry/Immunofluorescence: SLC25A43 Antibody [NBP1-86310] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.](http://images.novusbio.com/images2/SLC25A43-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-86310-img0004.jpg)
![Immunohistochemistry-Paraffin: SLC25A43 Antibody [NBP1-86310] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.](http://images.novusbio.com/images2/SLC25A43-Antibody-Immunohistochemistry-Paraffin-NBP1-86310-img0002.jpg)
Secondary Antibodies |
Isotype Controls |
Diseases for CXorf56/MRX107 Antibody (NBP3-10720)Discover more about diseases related to CXorf56/MRX107 Antibody (NBP3-10720).
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | STEEP1, CXORF56 |
![Immunohistochemistry-Paraffin: HR6A/UBE2A Antibody [NB100-553] - Section of human stomach carcinoma (left) and mouse squamous cell carcinoma (right). Antibody: Affinity purified rabbit anti- Rad6 used at a dilution of 1:1,000 (1ug/ml). Detection: DAB](http://images.novusbio.com/images2/HR6A-UBE2A-Antibody-Immunohistochemistry-NB100-553-img0016.jpg)
![Western Blot: HR6A/UBE2A Antibody [NB100-553] - Detection of Human Rad6 by Western Blot. Samples: Whole cell lysate (50 ug) from HeLa and 293T cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-Rad6 antibody NB100-553 used for WB at 0.04 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.](http://images.novusbio.com/images2/HR6A-UBE2A-Antibody-Western-Blot-NB100-553-img0019.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](http://images.novusbio.com/images2/Goat-anti-Rabbit-IgG-(H+L)-Secondary-Antibody-[HRP]-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
