CXorf56/MRX107 Antibody

Images

 
Western Blot: CXorf56/MRX107 Antibody [NBP2-87230] - Host: Rabbit. Target Name: CXorf56. Sample Type: Fetal Heart lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CXorf56/MRX107 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human CXorf56/MRX107. Peptide sequence: VTVSTIDEEEEEIEAREVADSYAQNAKVIEKQLERKGMSKRRLQELAELE The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
CXORF56
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CXorf56/MRX107 Antibody

  • chromosome X open reading frame 56
  • FLJ22965
  • hypothetical protein LOC63932

Background

While this gene is well-supported by transcript data, no functional information on its protein products is currentlyavailable. Three transcript variants encoding different isoforms have been found for this gene. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-92630
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB100-553
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP3-10499
Species: Hu
Applications: IHC, WB
NBP1-86310
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for CXorf56/MRX107 Antibody (NBP2-87230) (0)

There are no publications for CXorf56/MRX107 Antibody (NBP2-87230).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CXorf56/MRX107 Antibody (NBP2-87230) (0)

There are no reviews for CXorf56/MRX107 Antibody (NBP2-87230). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CXorf56/MRX107 Antibody (NBP2-87230) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CXorf56/MRX107 Products

Bioinformatics Tool for CXorf56/MRX107 Antibody (NBP2-87230)

Discover related pathways, diseases and genes to CXorf56/MRX107 Antibody (NBP2-87230). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CXorf56/MRX107 Antibody (NBP2-87230)

Discover more about diseases related to CXorf56/MRX107 Antibody (NBP2-87230).

Blogs on CXorf56/MRX107

There are no specific blogs for CXorf56/MRX107, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CXorf56/MRX107 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CXORF56