CNTD Antibody


Western Blot: CNTD Antibody [NBP1-57048] - ACHN cell lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

CNTD Antibody Summary

Synthetic peptides corresponding to CNTD1 (cyclin N-terminal domain containing 1) The peptide sequence was selected from the N terminal of CNTD1. Peptide sequence QNEQAVREASGRLGRFREPQIVEFVFLLSEQWCLEKSVSYQAVEILERFM.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against CNTD1 and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for CNTD Antibody

  • CNTD
  • cyclin N-terminal domain containing 1
  • cyclin N-terminal domain containing
  • cyclin N-terminal domain-containing protein 1
  • FLJ40137


The function of this protein remains unknown.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CNTD Antibody (NBP1-57048) (0)

There are no publications for CNTD Antibody (NBP1-57048).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CNTD Antibody (NBP1-57048) (0)

There are no reviews for CNTD Antibody (NBP1-57048). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CNTD Antibody (NBP1-57048) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional CNTD Products

Bioinformatics Tool for CNTD Antibody (NBP1-57048)

Discover related pathways, diseases and genes to CNTD Antibody (NBP1-57048). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on CNTD

There are no specific blogs for CNTD, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CNTD Antibody and receive a gift card or discount.


Gene Symbol CNTD1