CLRN3 Antibody

Images

 
Western Blot: CLRN3 Antibody [NBP1-81119] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunohistochemistry-Paraffin: CLRN3 Antibody [NBP1-81119] - Staining of human duodenum shows moderate cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CLRN3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RDSASNGSIFITYGLFRGESSEELSHGLAEPKKKFAVLEILNNSSQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CLRN3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin HIER pH6 retrieval is recommended.
Control Peptide
CLRN3 Protein (NBP1-81119PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CLRN3 Antibody

  • clarin 3
  • clarin-3
  • MGC32871
  • Transmembrane protein 12TMEM12
  • USH3AL1DKFZp686F11218
  • Usher syndrome type-3A-like protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81657
Species: Hu
Applications: IHC, IHC-P
NBP1-81119
Species: Hu
Applications: WB, IHC, IHC-P

Publications for CLRN3 Antibody (NBP1-81119) (0)

There are no publications for CLRN3 Antibody (NBP1-81119).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CLRN3 Antibody (NBP1-81119) (0)

There are no reviews for CLRN3 Antibody (NBP1-81119). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CLRN3 Antibody (NBP1-81119) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CLRN3 Antibody Products

Related Products by Gene

Bioinformatics Tool for CLRN3 Antibody (NBP1-81119)

Discover related pathways, diseases and genes to CLRN3 Antibody (NBP1-81119). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CLRN3 Antibody (NBP1-81119)

Discover more about diseases related to CLRN3 Antibody (NBP1-81119).
 

Pathways for CLRN3 Antibody (NBP1-81119)

View related products by pathway.

Blogs on CLRN3

There are no specific blogs for CLRN3, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CLRN3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CLRN3

Customers Who Bought This Also Bought