CHAC2 Antibody

Images

 
Western Blot: CHAC2 Antibody [NBP1-56821] - Human Placenta lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb, Ye, ZeSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CHAC2 Antibody Summary

Immunogen
Synthetic peptides corresponding to CHAC2(ChaC, cation transport regulator homolog 2 (E. coli)) The peptide sequence was selected from the N terminal of CHAC2. Peptide sequence MWVFGYGSLIWKVDFPYQDKLVGYITNYSRRFWQGSTDHRGVPGKPGRVV.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CHAC2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against CHAC2 and was validated on Western blot.
Publications
Read Publication using
NBP1-56821 in the following applications:

  • WB
    1 publication

Reactivity Notes

Rat reactivity reported in scientific literature (PMID: 25385761).

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for CHAC2 Antibody

  • cation transport regulator-like protein 2
  • ChaC, cation transport regulator homolog 2 (E. coli)
  • ChaC, cation transport regulator-like 2 (E. coli)
  • ChaC, cation transport regulator-like 2

Background

The specific function of this protein remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CHAC2 Antibody (NBP1-56821)(1)

We have publications tested in 1 confirmed species: Rat.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Rat
(1)
All Species

Reviews for CHAC2 Antibody (NBP1-56821) (0)

There are no reviews for CHAC2 Antibody (NBP1-56821). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CHAC2 Antibody (NBP1-56821) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional CHAC2 Products

Bioinformatics Tool for CHAC2 Antibody (NBP1-56821)

Discover related pathways, diseases and genes to CHAC2 Antibody (NBP1-56821). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on CHAC2

There are no specific blogs for CHAC2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CHAC2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CHAC2
Uniprot