![Western Blot: CATSPERE Antibody [NBP2-37849] - A549 Whole Cell lysates, Antibody Dilution: 1.0 ug/ml.](http://images.novusbio.com/fullsize2/CATSPERE-Antibody-Western-Blot-NBP2-37849-img0001.jpg "Western Blot: CATSPERE Antibody [NBP2-37849] - A549 Whole Cell lysates, Antibody Dilution: 1.0 ug/ml.")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | The immunogen for Anti-CA101 antibody is: synthetic peptide directed towards the N-terminal region of Human CA101.. Peptide sequence: CFLWYYRVRHFFNNFTQLITVWAYDPESADPDELLGNAEEPSINSIVLST The peptide sequence for this immunogen was taken from within the described region. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | C1orf101 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Theoretical MW | 91 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS and 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Western Blot: CATSPERE Antibody [NBP2-37849] - Host: Rabbit. Target Name: CA101. Sample Type: A549 Whole Cell lysates. Antibody Dilution: 1.0ug/ml](http://images.novusbio.com/fullsize2/CATSPERE-Antibody-Western-Blot-NBP2-37849-img0002.jpg "Western Blot: CATSPERE Antibody [NBP2-37849] - Host: Rabbit. Target Name: CA101. Sample Type: A549 Whole Cell lysates. Antibody Dilution: 1.0ug/ml")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images2/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")