CAMSAP3 Antibody

Immunocytochemistry/Immunofluorescence: KIAA1543 Antibody [NBP2-55757] - Staining of human cell line Hep G2 shows localization to nucleoplasm & centrosome.

Product Discontinued

CAMSAP3 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: DFCASRLPRGCPLSLEDLLYVPPPLKVNLVVMLAELFMCFEVLKPDFVQVKDLPDGHAASPRGTEASPPQNNSGSSSPV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CAMSAP3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Reactivity Notes

Mouse 87%, Rat 87%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for CAMSAP3 Antibody

• calmodulin regulated spectrin-associated protein family, member 3
• calmodulin-regulated spectrin-associated protein 3
• KIAA1543
• NEZHA
• protein Nezha

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CAMSAP3