Calpain 13 Recombinant Protein Antigen

Images

 
There are currently no images for Calpain 13 Protein (NBP2-14435PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Calpain 13 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CAPN13.

Source: E. coli

Amino Acid Sequence: ISRELLHLVTLRYSDSVGRVSFPSLVCFLMRLEAMAKTFRNLSKDGKGLYLTEMEWMSLVMYN

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CAPN13
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-14435.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Calpain 13 Recombinant Protein Antigen

  • Calcium-activated neutral proteinase 13
  • calpain 13
  • calpain-13
  • CANP 13
  • EC 3.4.22.-
  • FLJ23523

Background

Calpains are a family of cytosolic calcium-activated cysteine proteases involved in a variety of cellular processes including apoptosis, cell division, modulation of integrin-cytoskeletal interactions, and synaptic plasticity (Dear et al., 2000 [PubMed 10964513]). CAPN13 belongs to the calpain large subunit family.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00010753-M02
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-15937
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NBP2-15671
Species: Hu, Mu, Sq
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP2-01819
Species: Hu
Applications: Flow, IHC,  IHC-P, WB
NBP3-35199
Species: Mu, Rt
Applications: ELISA, ICC/IF, WB
NBP3-35199
Species: Mu, Rt
Applications: ELISA, ICC/IF, WB
NBP2-15671
Species: Hu, Mu, Sq
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP1-88204
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-09728
Species: Hu
Applications: WB
NBP1-47668
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, WB

Publications for Calpain 13 Protein (NBP2-14435PEP) (0)

There are no publications for Calpain 13 Protein (NBP2-14435PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Calpain 13 Protein (NBP2-14435PEP) (0)

There are no reviews for Calpain 13 Protein (NBP2-14435PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Calpain 13 Protein (NBP2-14435PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Calpain 13 Products

Blogs on Calpain 13

There are no specific blogs for Calpain 13, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Calpain 13 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CAPN13