Cadherin-23 Recombinant Protein Antigen

Images

 

Product Details

Summary
Product Discontinued
View other related Cadherin-23 Peptides and Proteins

Order Details


    • Catalog Number
      NBP1-85704PEP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Cadherin-23 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CDH23.

Source: E. coli

Amino Acid Sequence: YFVVDIVARDLAGHNDTAIIGIYILRDDQRVKIVINEIPDRVRGFEEEFIHLLSNITGAIVNTDNVQFHVDKKGRVNFAQTELLIHVVNRDTNRILDVDRVIQMIDENKEQLRNLFRNYNVLD

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CDH23
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85704.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Cadherin-23 Recombinant Protein Antigen

  • cadherin related 23
  • cadherin-23
  • cadherin-like 23
  • cadherin-related 23
  • cadherin-related family member 23
  • CDHR23
  • DKFZp434P2350
  • FLJ00233
  • FLJ36499
  • KIAA1774
  • KIAA1812
  • MGC102761
  • otocadherin
  • USH1D

Background

CDH23 is a member of the cadherin superfamily, whose genes encode calcium dependent cell-cell adhesion glycoproteins. The encoded protein is a large, single-pass transmembrane protein composed of an extracellular domain containing 27 repeats that show significant homology to the cadherin ectodomain. Expressed in the neurosensory epithelium, the protein is thought to be involved in stereocilia organization and hair bundle formation. The gene is located in a region containing the human deafness loci DFNB12 and USH1D. Usher syndrome 1D and nonsyndromic autosomal recessive deafness DFNB12 are caused by allelic mutations of this cadherin-like gene. Two alternative splice variants have been identified that encode different isoforms. Additional variants have been observed but their full-length nature has not been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-21878
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, WB
NBP1-89189
Species: Hu, Mu
Applications: IHC,  IHC-P
NBP2-20823
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-69142
Species: Hu
Applications: WB
NBP2-41304
Species: Hu, Po, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-57048
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-92296
Species: Hu, Rt
Applications: IHC, IHC-Fr,  IHC-P
NBP1-85237
Species: Hu
Applications: IHC,  IHC-P
H00025861-M05
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP1-46574
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NB120-3529
Species: Hu, Po, Rt
Applications: ELISA, IHC, IHC-Fr,  IHC-P, WB
NBP2-69069
Species: Hu
Applications: IHC,  IHC-P
NBP1-30981
Species: Hu, Mu
Applications: ICC/IF, WB

Publications for Cadherin-23 Protein (NBP1-85704PEP) (0)

There are no publications for Cadherin-23 Protein (NBP1-85704PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cadherin-23 Protein (NBP1-85704PEP) (0)

There are no reviews for Cadherin-23 Protein (NBP1-85704PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Cadherin-23 Protein (NBP1-85704PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Cadherin-23 Products

Research Areas for Cadherin-23 Protein (NBP1-85704PEP)

Find related products by research area.

Blogs on Cadherin-23

There are no specific blogs for Cadherin-23, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Cadherin-23 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CDH23