Recombinant Human Cadherin-23 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Cadherin-23 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 29-114 of Human CDH23 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:PFFTNHFFDTYLLISEDTPVGSSVTQLLAQDMDNDPLVFGVSGEEASRFFAVEPDTGVVWLRQPLDRETKSEFTVEFSVSDHQGVI

Protein/Peptide Type
Partial Recombinant Protein
Gene
CDH23

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Cadherin-23 Protein

  • cadherin related 23
  • cadherin-23
  • cadherin-like 23
  • cadherin-related 23
  • cadherin-related family member 23
  • CDHR23
  • DKFZp434P2350
  • FLJ00233
  • FLJ36499
  • KIAA1774
  • KIAA1812
  • MGC102761
  • otocadherin
  • USH1D

Background

CDH23 - cadherin-like 23

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF6729
Species: Hu
Applications: WB, IHC, ICC
NBP1-84266
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-89189
Species: Hu
Applications: IHC, IHC-P
NBP1-89076
Species: Hu
Applications: IHC, IHC-P
42720002
Species: Ze
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr
NLS1729
Species: Hu, Eq
Applications: WB, IHC-P
NBP1-92296
Species: Hu
Applications: IHC, IHC-P
NBP1-60106
Species: Hu
Applications: WB, IHC, IHC-P
H00025861-M05
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-46574
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB120-3529
Species: Hu, Rt, Po
Applications: WB, ELISA, IHC-Fr, IHC-P
H00051168-Q01
Species: Hu
NBP1-30981
Species: Hu, Mu
Applications: WB, ICC/IF
H00064072-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for Cadherin-23 Partial Recombinant Protein (H00064072-Q01) (0)

There are no publications for Cadherin-23 Partial Recombinant Protein (H00064072-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cadherin-23 Partial Recombinant Protein (H00064072-Q01) (0)

There are no reviews for Cadherin-23 Partial Recombinant Protein (H00064072-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Cadherin-23 Partial Recombinant Protein (H00064072-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Cadherin-23 Products

Bioinformatics Tool for Cadherin-23 Partial Recombinant Protein (H00064072-Q01)

Discover related pathways, diseases and genes to Cadherin-23 Partial Recombinant Protein (H00064072-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cadherin-23 Partial Recombinant Protein (H00064072-Q01)

Discover more about diseases related to Cadherin-23 Partial Recombinant Protein (H00064072-Q01).
 

Pathways for Cadherin-23 Partial Recombinant Protein (H00064072-Q01)

View related products by pathway.

Blogs on Cadherin-23

There are no specific blogs for Cadherin-23, but you can read our latest blog posts.

Customers Who Bought This Also Bought

SLC26A4 Antibody
NBP1-60106
USH1C Antibody
NBP1-89189

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Cadherin-23 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CDH23