C19orf71 Antibody


Western Blot: C19orf71 Antibody [NBP2-14650] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). ...read more
Immunocytochemistry/ Immunofluorescence: C19orf71 Antibody [NBP2-14650] - Staining of human cell line HeLa shows localization to plasma membrane, cytosol & endoplasmic reticulum.
Immunohistochemistry-Paraffin: C19orf71 Antibody [NBP2-14650] - Staining of human cerebral cortex shows strong granular cytoplasmic positivity in neuronal cells.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC

Order Details

C19orf71 Antibody Summary

This antibody was developed against a recombinant protein corresponding to the amino acids: AWEAWYNLPRALASPFREAYNRWHSCYQHRECSMPSAYTQHLRETAWHDPIVPAQYQAPSTRWGSALWKDRPI
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
C19orf71 Protein (NBP2-14650PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for C19orf71 Antibody

  • C19orf71 chromosome 19 open reading frame 71


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for C19orf71 Antibody (NBP2-14650) (0)

There are no publications for C19orf71 Antibody (NBP2-14650).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for C19orf71 Antibody (NBP2-14650) (0)

There are no reviews for C19orf71 Antibody (NBP2-14650). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for C19orf71 Antibody (NBP2-14650) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our C19orf71 Antibody and receive a gift card or discount.


Gene Symbol C19orf71