C19orf25 Antibody


Western Blot: C19orf25 Antibody [NBP2-14391] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Immunohistochemistry-Paraffin: C19orf25 Antibody [NBP2-14391] - Staining of human esophagus shows strong nuclear and cytoplasmic positivity in superficial cells of squamous epithelia.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC

Order Details

C19orf25 Antibody Summary

This antibody was developed against a recombinant protein corresponding to the amino acids: GEQLYQQSRAYVAANQRLQQAGNVLRQRCELLQRAGEDLEREVAQMKQAALPAAEAASSG
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
C19orf25 Protein (NBP2-14391PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for C19orf25 Antibody

  • chromosome 19 open reading frame 25
  • FLJ36666
  • hypothetical protein LOC148223


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for C19orf25 Antibody (NBP2-14391) (0)

There are no publications for C19orf25 Antibody (NBP2-14391).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for C19orf25 Antibody (NBP2-14391) (0)

There are no reviews for C19orf25 Antibody (NBP2-14391). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for C19orf25 Antibody (NBP2-14391) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our C19orf25 Antibody and receive a gift card or discount.


Gene Symbol C19ORF25