C14orf177 Antibody

Images

 
Western Blot: C14orf177 Antibody [NBP1-79606] - Titration: 0.2-1 ug/ml, Positive Control: 721_B cell lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

C14orf177 Antibody Summary

Immunogen
Synthetic peptide directed towards the N terminal of human C14orf177The immunogen for this antibody is C14orf177. Peptide sequence HKQGTKPMITRPSVSQLGEGKCPSSQHLQSLRHNKQHALTLTKARCCGEC.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
C14ORF177
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against C14orf177 and was validated on Western blot.
Theoretical MW
14 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for C14orf177 Antibody

  • chromosome 14 open reading frame 177
  • FLJ25773
  • hypothetical protein LOC283598
  • putative uncharacterized protein C14orf177

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for C14orf177 Antibody (NBP1-79606) (0)

There are no publications for C14orf177 Antibody (NBP1-79606).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for C14orf177 Antibody (NBP1-79606) (0)

There are no reviews for C14orf177 Antibody (NBP1-79606). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for C14orf177 Antibody (NBP1-79606) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for C14orf177 Antibody (NBP1-79606)

Discover related pathways, diseases and genes to C14orf177 Antibody (NBP1-79606). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on C14orf177

There are no specific blogs for C14orf177, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our C14orf177 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol C14ORF177
Uniprot