C14orf159 Antibody

Images

 
Western Blot: C14orf159 Antibody [NBP1-81920] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). ...read more
Immunocytochemistry/ Immunofluorescence: C14orf159 Antibody [NBP1-81920] - Staining of human cell line U-251 MG shows positivity in cytoplasm and cytoskeleton (microtubules).
Immunohistochemistry-Paraffin: C14orf159 Antibody [NBP1-81920] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

C14orf159 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:AGAYKTTVPCVTHAGFCCPLVVTMRPIPKDKLEGLVRACCSLGGEQGQPVHMGDPELLGIKELSKPAYGDAMVCPPGEVPVFWPSPLTSLGAVSSCETPLA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
C14ORF159
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:250 - 1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin HIER pH6 retrieval is recommended.
Control Peptide
C14orf159 Protein (NBP1-81920PEP)
Publications
Read Publication using NBP1-81920.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for C14orf159 Antibody

  • C14orf160
  • chromosome 14 open reading frame 159
  • DKFZp686I02128
  • FLJ20950
  • FLJ39943
  • FLJ39975
  • hypothetical protein LOC80017

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for C14orf159 Antibody (NBP1-81920)(1)

Reviews for C14orf159 Antibody (NBP1-81920) (0)

There are no reviews for C14orf159 Antibody (NBP1-81920). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for C14orf159 Antibody (NBP1-81920) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional C14orf159 Antibody Products

Bioinformatics Tool for C14orf159 Antibody (NBP1-81920)

Discover related pathways, diseases and genes to C14orf159 Antibody (NBP1-81920). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on C14orf159

There are no specific blogs for C14orf159, but you can read our latest blog posts.

Contact Information

Product PDFs

Review this Product

Be the first to review our C14orf159 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol C14ORF159

Customers Who Bought This Also Bought