C12orf42 Antibody


Western Blot: C12orf42 Antibody [NBP1-70431] - 721_B cell lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB
0.5 mg/ml

Order Details

C12orf42 Antibody Summary

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Synthetic peptides corresponding to C12ORF42 The peptide sequence was selected from the N terminal of C12ORF42. Peptide sequence PRCSVSTVSFDEESYEEFRSSPAPSSETDEAPLIFTARGETEERARGAPK. The peptide sequence for this immunogen was taken from within the described region.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1.0 ug/ml
Theoretical MW
40 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS, 2% Sucrose
0.09% Sodium Azide
0.5 mg/ml
Affinity purified

Alternate Names for C12orf42 Antibody

  • chromosome 12 open reading frame 42
  • FLJ25323
  • hypothetical protein LOC374470
  • MGC57409


The exact function of C12orf42 remains unknown.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for C12orf42 Antibody (NBP1-70431) (0)

There are no publications for C12orf42 Antibody (NBP1-70431).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for C12orf42 Antibody (NBP1-70431) (0)

There are no reviews for C12orf42 Antibody (NBP1-70431). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for C12orf42 Antibody (NBP1-70431) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional C12orf42 Products

Array NBP1-70431

Diseases for C12orf42 Antibody (NBP1-70431)

Discover more about diseases related to C12orf42 Antibody (NBP1-70431).

Pathways for C12orf42 Antibody (NBP1-70431)

View related products by pathway.

Blogs on C12orf42

There are no specific blogs for C12orf42, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our C12orf42 Antibody and receive a gift card or discount.


Gene Symbol C12ORF42