![Western Blot: BTNL3 Antibody [H00010917-B01P] - Analysis of BTNL3 expression in HepG2.](http://images.novusbio.com/fullsize/BTNL3-Antibody-Western-Blot-H00010917-B01P-img0002.jpg "Western Blot: BTNL3 Antibody [H00010917-B01P] - Analysis of BTNL3 expression in HepG2.")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Description | Novus Biologicals Mouse BTNL3 Antibody - Azide and BSA Free (H00010917-B01P) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | BTNL3 (NP_932079.1, 1 a.a. - 466 a.a.) full-length human protein. MAFVLILVLSFYELVSGQWQVTGPGKFVQALVGEDAVFSCSLFPETSAEAMEVRFFRNQFHAVVHLYRDGEDWESKQMPQYRGRTEFVKDSIAGGRVSLRLKNITPSDIGLYGCWFSSQIYDEEATWELRVAALGSLPLISIVGYVDGGIQLLCLSSGWFPQPTAKWKGPQGQDLSSDSRANADGYSLYDVEISIIVQENAGSILCSIHLAEQSHEVESKVLIGETFFQPSPWRLASILLGLLCGALCGVVMGMIIVFFKSKGKIQAELDWRRKHGQAELRDARKHAVEVTLDPETAHPKLCVSDLKTVTHRKAPQEVPHSEKRFTRKSVVASQGFQAGKHYWEVDVGQNVGWYVGVCRDDVDRGKNNVTLSPNNGYWVLRLTTEHLYFTFNPHFISLPPSTPPTRVGVFLDYEGGTISFFNTNDQSLIYTLLTCQFEGLLRPYIQHAMYDEEKGTPIFICPVSWG |
| Specificity | Reacts with butyrophilin-like 3. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Mouse |
| Gene | BTNL3 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | This antibody is reactive against transfected lysate in western blot, and as a detection antibody in ELISA. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | Protein A purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | BTNL3 |
| Entrez |
|
| Uniprot |
|
![Western Blot: BTNL3 Antibody [H00010917-B01P] - Analysis of BTNL3 expression in transfected 293T cell line by BTNL3 polyclonal antibody. Lane1:BTNL3 transfected lysate(51.26 KDa). Lane2:Non-transfected lysate.](http://images.novusbio.com/fullsize/BTNL3-Antibody-Western-Blot-H00010917-B01P-img0003.jpg "Western Blot: BTNL3 Antibody [H00010917-B01P] - Analysis of BTNL3 expression in transfected 293T cell line by BTNL3 polyclonal antibody. Lane1:BTNL3 transfected lysate(51.26 KDa). Lane2:Non-transfected lysate.")
![Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]](https://images.novusbio.com/images/Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP1-97019-img0004.jpg "Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]")