BTBD18 Antibody

Images

 
Western Blot: BTBD18 Antibody [NBP2-82801] - Host: Rabbit. Target Name: BTBD18. Sample Type: 721_B Whole Cell lysates. Antibody Dilution: 1.0ug/mlBTBD18 is supported by BioGPS gene expression data to be expressed in ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

BTBD18 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human BTBD18. Peptide sequence: IEGEEWCLPDMELWPRELTELEKEPAGENRGPTELLSPLVMPSEVSEVLS
Clonality
Polyclonal
Host
Rabbit
Gene
BTBD18
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for BTBD18 Antibody

  • BTBD18 BTB (POZ) domain containing 18

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-92025
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for BTBD18 Antibody (NBP2-82801) (0)

There are no publications for BTBD18 Antibody (NBP2-82801).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BTBD18 Antibody (NBP2-82801) (0)

There are no reviews for BTBD18 Antibody (NBP2-82801). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BTBD18 Antibody (NBP2-82801) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional BTBD18 Products

Bioinformatics Tool for BTBD18 Antibody (NBP2-82801)

Discover related pathways, diseases and genes to BTBD18 Antibody (NBP2-82801). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BTBD18 Antibody (NBP2-82801)

Discover more about diseases related to BTBD18 Antibody (NBP2-82801).

Blogs on BTBD18

There are no specific blogs for BTBD18, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BTBD18 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BTBD18