Arpin Antibody

Images

 
Western Blot: Arpin Antibody [NBP1-91468] - Mouse Spleen Lysate 1ug/ml Gel Concentration 12%

Product Details

Summary
Reactivity MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Arpin Antibody Summary

Immunogen
The specific Immunogen is proprietary information. Peptide sequence RYYVLYIQPSCIHRRKFDPKGNEIEPNFSATRKVNTGFLMSSYKVEAKGD. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
C15ORF38
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against 2610034B18Rik and was validated on Western blot.
Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Arpin Antibody

  • 2610034B18Rik
  • C15orf38
  • RIKEN cDNA 2610034B18 gene

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Arpin Antibody (NBP1-91468) (0)

There are no publications for Arpin Antibody (NBP1-91468).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Arpin Antibody (NBP1-91468) (0)

There are no reviews for Arpin Antibody (NBP1-91468). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Arpin Antibody (NBP1-91468) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Arpin Products

Bioinformatics Tool for Arpin Antibody (NBP1-91468)

Discover related pathways, diseases and genes to Arpin Antibody (NBP1-91468). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on Arpin

There are no specific blogs for Arpin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Arpin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol C15ORF38
Uniprot