ARMCX6 Antibody


Western Blot: ARMCX6 Antibody [NBP1-91581] - Titration: 5.0ug/ml Positive Control: Jurkat cell lysate.
Immunohistochemistry-Paraffin: ARMCX6 Antibody [NBP1-91581] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

ARMCX6 Antibody Summary

Synthetic peptide directed towards the N terminal of human ARMCX6 (NP_061880). Peptide sequence TMARPWTEDGDWTEPGAPGGTEDRPSGGGKANRAHPIKQRPFPYEHKNTW. The peptide sequence for this immunogen was taken from within the described region.
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 4-8 ug/ml
  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against ARMCX6 and was validated on Western Blot and immunohistochemistry.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Protein A purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ARMCX6 Antibody

  • armadillo repeat containing, X-linked 6
  • FLJ20811
  • protein ARMCX6


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ARMCX6 Antibody (NBP1-91581) (0)

There are no publications for ARMCX6 Antibody (NBP1-91581).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARMCX6 Antibody (NBP1-91581) (0)

There are no reviews for ARMCX6 Antibody (NBP1-91581). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ARMCX6 Antibody (NBP1-91581) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional ARMCX6 Products

Bioinformatics Tool for ARMCX6 Antibody (NBP1-91581)

Discover related pathways, diseases and genes to ARMCX6 Antibody (NBP1-91581). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on ARMCX6

There are no specific blogs for ARMCX6, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ARMCX6 Antibody and receive a gift card or discount.


Gene Symbol ARMCX6