Recombinant Human ALOX12P2 Protein

Images

 
SDS-Page: Recombinant Human ALOX12P2 Protein [H00000245-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human ALOX12P2 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-256 of Human ALOX12P2 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MVKLRKHNVLLSLDWFCKWISVQGPGTQGAAFFPCYRWVQGHGIICLPEGTARTVSDDPQNLFKKYREQELEERRWGSWKDGLILPIAGNRQPDLPRDERFLEDKDLDFNVSLAKGLKDLAIKGTLDFINCVKRLEDFKKIFPHGKTVLAERVYDSWKNDAFFGYQFLNGANPMLLRCTSRLPACLVLPPGMEDLKTQLEKELQAGSLFEVDFSLLDGVKPNVIIFKQQCVAAPLVMLKLQPDGGLLPMVIQLQPP

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
ALOX12P2
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ALOX12P2 Protein

  • ALOX12E
  • arachidonate 12-lipoxygenase pseudogene 2
  • MGC43625

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29941
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00005694-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
AF6567
Species: Hu, Mu
Applications: WB, IHC
AF976
Species: Hu, Pm
Applications: WB, Flow, IHC, CyTOF-ready, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP2-16155
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85161
Species: Hu
Applications: IHC, IHC-P
NBP2-01740
Species: Hu, Rt, Ca, Mk, Pm
Applications: WB, ICC/IF, IHC, IHC-P
H00006223-M01
Species: Hu
Applications: WB, ELISA
NBP2-23721
Species: Hu, Pm
Applications: WB, IHC, IHC-P
H00000245-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for ALOX12P2 Recombinant Protein (H00000245-P01) (0)

There are no publications for ALOX12P2 Recombinant Protein (H00000245-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ALOX12P2 Recombinant Protein (H00000245-P01) (0)

There are no reviews for ALOX12P2 Recombinant Protein (H00000245-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ALOX12P2 Recombinant Protein (H00000245-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ALOX12P2 Products

ALOX12P2 H00000245-P01

Bioinformatics Tool for ALOX12P2 Recombinant Protein (H00000245-P01)

Discover related pathways, diseases and genes to ALOX12P2 Recombinant Protein (H00000245-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for ALOX12P2 Recombinant Protein (H00000245-P01)

View related products by pathway.

Blogs on ALOX12P2

There are no specific blogs for ALOX12P2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ALOX12P2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ALOX12P2