ADAD2 Antibody

Western Blot: ADAD2 Antibody [NBP1-57511] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

ADAD2 Antibody Summary

• Immunogen: Synthetic peptides corresponding to ADAD2(adenosine deaminase domain containing 2) The peptide sequence was selected from the C terminal of ADAD2. Peptide sequence TPDTCRGLSLNWSLGDPGIEVVDVATGRVKANAALGPPSRLCKASFLRAF. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ADAD2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Application Notes: This is a rabbit polyclonal antibody against ADAD2 and was validated on Western blot.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS & 2% Sucrose.
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ADAD2 Antibody

• adenosine deaminase domain containing 2
• adenosine deaminase domain-containing protein 2
• TENRLFLJ00337
• Testis nuclear RNA-binding protein-like

Background

ADAD2 belongs to the ADAD family, and contains 1 A to I editase domain and 1 DRBM (double-stranded RNA-binding) domain. The exact functions of ADAD2 remain unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ADAD2
• Uniprot:
  • Q8NCV1(Human)