Recombinant Human ACTL7B GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Product Discontinued
View other related ACTL7B Peptides and Proteins

Order Details


    • Catalog Number
      H00010880-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human ACTL7B GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 286-377 of Human ACTL7B

Source: Wheat Germ (in vitro)

Amino Acid Sequence: GKLITIGQERFRCSEMLFQPSLAGSTQPGLPELTAACLGRCQDTGFKEEMAANVLLCGGCTMLDGFPERFQRELSLLCPGDSPAVAAAPERK

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
ACTL7B
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
35.86 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ACTL7B GST (N-Term) Protein

  • actin-like 7B
  • actin-like 7-beta
  • actin-like protein 7B
  • actin-like-7-beta
  • Tact1

Background

The protein encoded by this gene is a member of a family of actin-related proteins (ARPs) which share significant amino acid sequence identity to conventional actins. Both actins and ARPs have an actin fold, which is an ATP-binding cleft, as a common feature. The ARPs are involved in diverse cellular processes, including vesicular transport, spindle orientation, nuclear migration and chromatin remodeling. This gene (ACTL7B), and related gene, ACTL7A, are intronless, and are located approximately 4 kb apart in a head-to-head orientation within the familial dysautonomia candidate region on 9q31. Based on mutational analysis of the ACTL7B gene in patients with this disorder, it was concluded that it is unlikely to be involved in the pathogenesis of dysautonomia. Unlike ACTL7A, the ACTL7B gene is expressed predominantly in the testis, however, its exact function is not known.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86014
Species: Hu
Applications: IHC,  IHC-P
NBP3-42341
Species: Hu, Po, Rt
Applications: IHC,  IHC-P, WB
NBP1-33341
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
MAB7265
Species: Mu
Applications: IHC, WB

Publications for ACTL7B Partial Recombinant Protein (H00010880-Q01) (0)

There are no publications for ACTL7B Partial Recombinant Protein (H00010880-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ACTL7B Partial Recombinant Protein (H00010880-Q01) (0)

There are no reviews for ACTL7B Partial Recombinant Protein (H00010880-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ACTL7B Partial Recombinant Protein (H00010880-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ACTL7B Products

Research Areas for ACTL7B Partial Recombinant Protein (H00010880-Q01)

Find related products by research area.

Blogs on ACTL7B

There are no specific blogs for ACTL7B, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ACTL7B GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ACTL7B