ACSF2 Antibody

Images

 
Western Blot: ACSF2 Antibody [NBP1-74274] - Human Fetal Lung Cell Lysate, concentration 1 ug/ml.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ACSF2 Antibody Summary

Immunogen
Synthetic peptides corresponding to thetase family member 2 Antibody against the C terminal of ACSF2. Immunizing peptide sequence DLVVAYGTTENSPVTFAHFPEDTVEQKAESVGRIMPHTEARIMNMEAGTL.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ACSF2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against ACSF2 and was validated on Western blot.
Theoretical MW
68 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ACSF2 Antibody

  • ACSMW
  • acyl-CoA synthetase family member 2
  • AVYV493
  • EC 6.2.1
  • EC 6.2.1.-
  • EC 6.2.1.26
  • mitochondrial
  • PPARG binding, long chain fatty acid acyl Co-A ligase like

Background

Acyl-CoA synthases catalyze the initial reaction in fatty acid metabolism, by forming a thioester with CoA. ACSF2 has some preference toward medium-chain substrates. It plays a role in adipodyte differentiation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ACSF2 Antibody (NBP1-74274) (0)

There are no publications for ACSF2 Antibody (NBP1-74274).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ACSF2 Antibody (NBP1-74274) (0)

There are no reviews for ACSF2 Antibody (NBP1-74274). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ACSF2 Antibody (NBP1-74274) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ACSF2 Products

Bioinformatics Tool for ACSF2 Antibody (NBP1-74274)

Discover related pathways, diseases and genes to ACSF2 Antibody (NBP1-74274). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for ACSF2 Antibody (NBP1-74274)

Find related products by research area.

Blogs on ACSF2

There are no specific blogs for ACSF2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ACSF2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ACSF2
Uniprot