| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Concentration | 0.5 mg/ml |
| Description | The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
| Immunogen | Synthetic peptides corresponding to ACBD7(acyl-Coenzyme A binding domain containing 7) The peptide sequence was selected from the N terminal of ACBD7 (NP_001034933). Peptide sequence MALQADFDRAAEDVRKLKARPDDGELKELYGLYKQAIVGDINIACPGMLD. The peptide sequence for this immunogen was taken from within the described region. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ACBD7 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | Use in Immunohistochemistry reported in scientific literature (PMID 26880548). |
|
| Theoretical MW | 10 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
|
| Reviewed Applications |
|
|
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 0.5 mg/ml |
| Purity | Affinity purified |
| Publication using NBP1-56527 | Applications | Species |
|---|---|---|
| Lanfray D, Caron A, Roy MC et al. Involvement of the Acyl-CoA binding domain containing 7 in the control of food intake and energy expenditure in mice Elife 2016-03-24 [PMID: 26880548] (IF/IHC, WB, Mouse) | IF/IHC, WB | Mouse |
| Images | Ratings | Applications | Species | Date | Details | ||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Damien LANFRAY |
IF | Mouse | 03/19/2016 |
Summary
|
||||||
Enlarge |
reviewed by:
Damien LANFRAY |
ICC | Mouse | 03/19/2016 |
Summary
|
||||||
Enlarge |
reviewed by:
Damien LANFRAY |
ICC | Mouse | 03/19/2016 |
Summary
|
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
5 | |
4 | |
3 | |
2 | |
1 |
| Damien LANFRAY 03/19/2016 |
||
| Application: | IF | |
| Species: | Mouse |
| Damien LANFRAY 03/19/2016 |
||
| Application: | ICC | |
| Species: | Mouse |
| Damien LANFRAY 03/19/2016 |
||
| Application: | ICC | |
| Species: | Mouse |