ACBD7 Antibody - BSA Free

Western Blot: ACBD7 Antibody [NBP1-56527] - Human Brain lysate, concentration 0.2-1 ug/ml.

Immunocytochemistry/Immunofluorescence: ACBD7 Antibody [NBP1-56527] - Mouse arcuate nucleus stained with ACBD7 antibody. Image from verified customer review.

Immunohistochemistry-Paraffin: ACBD7 Antibody [NBP1-56527] - Mouse arcuate nucleus stained with ACBD7 (brown) and GFAP (black) antibodies. Image from verified customer review.

Immunocytochemistry/Immunofluorescence: ACBD7 Antibody [NBP1-56527] - Analysis of ACBD7 in 3T3-L1 cells using ACBD7 antibody. Image from verified customer review.

• Reactivity: Hu, Mu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

ACBD7 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to ACBD7(acyl-Coenzyme A binding domain containing 7) The peptide sequence was selected from the N terminal of ACBD7 (NP_001034933). Peptide sequence MALQADFDRAAEDVRKLKARPDDGELKELYGLYKQAIVGDINIACPGMLD. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ACBD7
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:10-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Western Blot 1.0 ug/ml
• Application Notes: Use in Immunohistochemistry reported in scientific literature (PMID 26880548).
• Theoretical MW: 10 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 26880548)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for ACBD7 Antibody - BSA Free

• acyl-CoA binding domain containing 7
• acyl-CoA-binding domain-containing protein 7
• acyl-Coenzyme A binding domain containing 7
• bA455B2.2
• FLJ38219
• FLJ52263
• MGC33893

Background

The function of this protein remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ACBD7 Antibody (NBP1-56527)(1)

Publication using NBP1-56527

• Lanfray D, Caron A, Roy MC et al. Involvement of the Acyl-CoA binding domain containing 7 in the control of food intake and energy expenditure in mice Elife 2016-03-24 [PMID: 26880548] (IF/IHC, WB, Mouse)

Reviews for ACBD7 Antibody (NBP1-56527) (3)

Average Rating: 4.7

(Based on 3 reviews)

We have 3 reviews tested in 1 species: Mouse.

reviewed by: Damien LANFRAY IF Mouse 03/19/2016

Summary

• Application: Immunofluorescence
• Species: Mouse
• Lot: QC27192-100324

reviewed by: Damien LANFRAY ICC Mouse 03/19/2016

Summary

• Application: Immunocytochemistry
• Species: Mouse
• Lot: QC27192-100324

reviewed by: Damien LANFRAY ICC Mouse 03/19/2016

Summary

• Application: Immunocytochemistry
• Species: Mouse
• Lot: QC27192-100324

Bioinformatics

• Gene Symbol: ACBD7
• Entrez:
  • 414149(Human)
• Uniprot:
  • Q8N6N7(Human)