ZNF8 Antibody (2C6)

Images

 
Sandwich ELISA: ZNF8 Antibody (2C6) [H00007554-M03] - Detection limit for recombinant GST tagged ZNF8 is 3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
2C6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ZNF8 Antibody (2C6) Summary

Immunogen
ZNF8 (NP_066575.1, 82 a.a. - 180 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ELWVAERGTTQGCHPAWEPRSESQASRKEEGLPEEEPSHVTGREGFPTDAPYPTTLGKDRECQSQSLALKEQNNLKQLEFGLKEAPVQDQGYKTLRLRE
Specificity
Reacts with zinc finger protein 8.
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ZNF8
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
This antibody is reactive against recombinant protein in WB and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ZNF8 Antibody (2C6)

  • HF.18
  • Zfp128
  • zinc finger protein 272
  • zinc finger protein 8 (clone HF.18)
  • zinc finger protein 8
  • Zinc finger protein HF.18

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-60018
Species: Hu
Applications: WB
NBP2-45808
Species: Hu
Applications: IHC
NB100-56656
Species: Hu, Mu, Rt
Applications: WB
NBP1-83264
Species: Hu
Applications: WB, IHC, IHC-P

Publications for ZNF8 Antibody (H00007554-M03) (0)

There are no publications for ZNF8 Antibody (H00007554-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF8 Antibody (H00007554-M03) (0)

There are no reviews for ZNF8 Antibody (H00007554-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZNF8 Antibody (H00007554-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZNF8 Products

Bioinformatics Tool for ZNF8 Antibody (H00007554-M03)

Discover related pathways, diseases and genes to ZNF8 Antibody (H00007554-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for ZNF8 Antibody (H00007554-M03)

View related products by pathway.

Blogs on ZNF8

There are no specific blogs for ZNF8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZNF8 Antibody (2C6) and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF8
Entrez
Uniprot