ZNF486 Antibody - Azide and BSA Free

Western Blot: ZNF486 Antibody [H00090649-B01P] - Analysis of ZNF486 expression in transfected 293T cell line by ZNF486 polyclonal antibody. Lane 1: ZNF486 transfected lysate(23.76 KDa). Lane 2: Non-transfected lysate.

Immunocytochemistry/Immunofluorescence: ZNF486 Antibody [H00090649-B01P] - Analysis of purified antibody to ZNF486 on HeLa cell. (antibody concentration 10 ug/ml)

• Reactivity: Hu
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

ZNF486 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse ZNF486 Antibody - Azide and BSA Free (H00090649-B01P) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: ZNF486 (Q96H40, 1 a.a. - 216 a.a.) full-length human protein. MESLQFRDVAVEFSLEEWHCLDTAQQNLYRDVMLENYRHLVFLGIIVSKPDLITCLEQGIKPLTMKRHEMIAKPPVVCSHFAQDLWPEQSIKDSYQKVILRKFEKCGHGNLHFKKGCESVDECKLHKRGYNGLNQCLTTTQSKIFQCGKYVKVFHQFSNSKRHKRRHTEKKPLKYIEGDKAFNQSSTHTTHKKIDTGEKPYKCEECGKAFNRSSCL
• Specificity: ZNF486 - zinc finger protein 486,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: ZNF486
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot 1:500
• Application Notes: Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. Has also been used for immunofluorescence.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ZNF486 Antibody - Azide and BSA Free

• KOX16MGC57283
• Zfp612
• zinc finger protein 23 (KOX 16)
• zinc finger protein 23
• zinc finger protein 32
• Zinc finger protein 359ZNF612kruppel-like zinc finger factor X31
• Zinc finger protein 612
• Zinc finger protein KOX16
• ZNF359

Background

ZNF486 may be involved in transcriptional regulation

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ZNF486
• Entrez:
  • 90649(Human)
• Uniprot:
  • Q96H40(Human)