ZNF391 Antibody

Images

 
Immunohistochemistry-Paraffin: ZNF391 Antibody [NBP2-14715] - Staining of human stomach shows strong cytoplasmic and nuclear positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZNF391 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: NTAQGPTNEEDYKNEGQLSRQTKCPAQKKSSFENTVVRKVSVTLKEIFTG EEGPESSEFSLSPNLDAQQKIPKG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZNF391
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ZNF391 Protein (NBP2-14715PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZNF391 Antibody

  • dJ153G14.3
  • ZNF391 zinc finger protein 391

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-61007
Species: Hu, Alp, AB, Bv, Ca, Eq, Fe, Ft, Gt, Ha, Ll, Mn, Rb, Sh, WB
Applications: Flow, Func, IHC
NBP2-53380
Species: Hu
Applications: ICC/IF, IHC-P, PAGE
NBP2-02864
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-14093
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-43728
Species: Hu
Applications: WB, ICC/IF
H00003126-M01
Species: Hu
Applications: WB, ELISA, IHC-P
H00003125-B02P
Species: Hu
Applications: WB, Flow
NB100-91244
Species: Hu
Applications: WB, IHC, IHC-Fr, IHC-P

Publications for ZNF391 Antibody (NBP2-14715) (0)

There are no publications for ZNF391 Antibody (NBP2-14715).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF391 Antibody (NBP2-14715) (0)

There are no reviews for ZNF391 Antibody (NBP2-14715). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ZNF391 Antibody (NBP2-14715) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZNF391 Products

ZNF391 NBP2-14715

Bioinformatics Tool for ZNF391 Antibody (NBP2-14715)

Discover related pathways, diseases and genes to ZNF391 Antibody (NBP2-14715). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNF391 Antibody (NBP2-14715)

Discover more about diseases related to ZNF391 Antibody (NBP2-14715).

PTMs for ZNF391 Antibody (NBP2-14715)

Learn more about PTMs related to ZNF391 Antibody (NBP2-14715).

Blogs on ZNF391

There are no specific blogs for ZNF391, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZNF391 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF391