ZNF26 Antibody

Images

 
Western Blot: ZNF26 Antibody [H00007574-B01P] - Analysis of ZNF26 expression in transfected 293T cell line by ZNF26 polyclonal antibody. Lane 1: ZNF26 transfected lysate(21.89 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ZNF26 Antibody Summary

Immunogen
ZNF26 (AAH08211, 1 a.a. - 199 a.a.) full-length human protein. MHTGEKPYQCSDCGKAFNMKTQLIVHQGVHTGNNPYQCGECGKAFGRKEQLTAHLRAHAGEKPYGCSECGKAFSSKSYLVIHRRTHTGERPYECSLCERAFCGKSQLIIHQRTHSTEKPYECNECEKAYPRKASLQIHQKTHSGEKPFKCSECGKAFTQKSSLSEHQRVHTGEKPWKCSECGKSFCWNSGLRIHRKTHK
Specificity
ZNF26 - zinc finger protein 26 (KOX 20),
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
ZNF26
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ZNF26 Antibody

  • EZI
  • Zfp467
  • zinc finger protein 467
  • zinc finger protein EZI

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ZNF26 Antibody (H00007574-B01P) (0)

There are no publications for ZNF26 Antibody (H00007574-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF26 Antibody (H00007574-B01P) (0)

There are no reviews for ZNF26 Antibody (H00007574-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZNF26 Antibody (H00007574-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZNF26 Products

Bioinformatics Tool for ZNF26 Antibody (H00007574-B01P)

Discover related pathways, diseases and genes to ZNF26 Antibody (H00007574-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on ZNF26

There are no specific blogs for ZNF26, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZNF26 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF26
Entrez
Uniprot