Recombinant Human ZNF257 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human ZNF257 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 531 of Human ZNF257 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MLENYRNLVFLGIAVSKPDLITCLEQGKEPCNMKRHEMVAKPPVMCSHIAEDLCPERDIKYFFQKVILRRYDKCEHENLQLRKGCKSVDECKVCKGGYNGLNQCLITTQSKMYQCDKYVKVFYKFSNSDRHKIRHTEKKTCKCKECGKSFCMLSQLTRHKRIHIRENSHKCEECGKAFNQSSALTRHKMTHTGEKPYKCEECGKAFNRSSHLTQHKVIHTREKPYKCEECGKAFNRSSHITQHKRIHNREKPFKYDECCKAFKWSSALTTLTQHKRIHTGEKPYKCEECGKAFNQSSALTRHKMIHTGEKPFQCEECGKAFNGSSHLTQHKIIHTKEKPYKCEECGKAFNRSSHLTKHKRIHTREKAYKCDEYCKAFNWSSALTTLTQHKIIHTGEKPYKCEECGKAFNRSSYLIRHKIIHTGEKPYKCEECGKAFNQSSHLTQHKIIHTGEKPYKCEECGKAFNRSSHLSQHKIIHTGEKPYKCEECGKPFNRFSYLTVHKRIHAGENPNKYEECGKACNHSSNLTKHNS

Protein/Peptide Type
Recombinant Protein
Gene
ZNF257

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ZNF257 Protein

  • MGC32104
  • zinc finger protein 480

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00056242-Q01
Species: Hu
H00009534-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
H00010172-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-30794
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-82866
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00113835-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for ZNF257 Recombinant Protein (H00113835-P01) (0)

There are no publications for ZNF257 Recombinant Protein (H00113835-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF257 Recombinant Protein (H00113835-P01) (0)

There are no reviews for ZNF257 Recombinant Protein (H00113835-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZNF257 Recombinant Protein (H00113835-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ZNF257 Products

Bioinformatics Tool for ZNF257 Recombinant Protein (H00113835-P01)

Discover related pathways, diseases and genes to ZNF257 Recombinant Protein (H00113835-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNF257 Recombinant Protein (H00113835-P01)

Discover more about diseases related to ZNF257 Recombinant Protein (H00113835-P01).

Blogs on ZNF257

There are no specific blogs for ZNF257, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ZNF24 Antibody
NBP1-82866
ZNF257 Antibody
H00113835-B01P
ZNF256 Antibody (3H7)
H00010172-M01
ZNF224 Antibody
NBP2-30794

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ZNF257 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF257