Recombinant Human ZNF254 Protein

Images

 
SDS-Page: Recombinant Human ZNF254 Protein [H00009534-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE

Order Details

Recombinant Human ZNF254 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-659 of Human ZNF254 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MPGPPRSLEMGLLTFRDVAIEFSLEEWQHLDIAQQNLYRNVMLENYRNLAFLGIAVSKPDLITCLEQGKEPWNMKRHEMVDEPPGMCPHFAQGLWPEQGMEDSFQKAILRRYGKYGHENLQLRKGCKSVDEYKVNKEGYNGLNQCFTTAQSKVFQCDKYLKVFYKFLNSNRPKIRHTEKKSFKCKKRVKLFCMLSHKTQHKSIYHREKSYKCKECGKTFNWSSTLTNHRKIYTEEKPYKCEEYNKSPKQLSTLTTHEIIHAGEKLYKCEECGEAFNRSSNLTTHKIIHTGEKPYKCEECGKAFIWSSTLTEHKKIHTRKKPYKCEECGKAFIWSSTLTRHKRMHTGEKPYKCEECGKAFSQSSTLTTHKIIHTGEKRYKCLECGKAFKQLSTLTTHKIIHVGEKLYKCEECGKGFNRSSNLTTHKIIHTGEKPYKCEECGKAFIWSSTLTKHKRIHTREKPYKCEECGKAFIWSSTLTRHKRMHTGEKPYKCEECGKSFSQSSTLTTHKIIHTGEKPYKCEECGKAFNWSSTLTKHNIIHTEEKPYKCEKCGKAFKQSSILTNHKRIHTGEKPYKCEECGKSFNRSSTFTKHKVIHTGVKPYKCEECGKAFFWSSTLTKHKRIHTGEQPYKWEKFGKAFNRSSHLTTDKITHWREILQV

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
ZNF254
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ZNF254 Protein

  • BA526D8.4
  • FLJ33884
  • KRAB box containing C2H2 type zinc finger bA526D8.4
  • MGC133033
  • MGC133034
  • zinc finger protein 484

Background

ZNF254 - zinc finger protein 254

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00113835-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
H00056242-Q01
Species: Hu
H00010172-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-30794
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-82866
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00009534-P01
Species: Hu
Applications: WB, ELISA, PA, PAGE

Publications for ZNF254 Recombinant Protein (H00009534-P01) (0)

There are no publications for ZNF254 Recombinant Protein (H00009534-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF254 Recombinant Protein (H00009534-P01) (0)

There are no reviews for ZNF254 Recombinant Protein (H00009534-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZNF254 Recombinant Protein (H00009534-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ZNF254 Products

Bioinformatics Tool for ZNF254 Recombinant Protein (H00009534-P01)

Discover related pathways, diseases and genes to ZNF254 Recombinant Protein (H00009534-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNF254 Recombinant Protein (H00009534-P01)

Discover more about diseases related to ZNF254 Recombinant Protein (H00009534-P01).

Blogs on ZNF254

There are no specific blogs for ZNF254, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ZNF24 Antibody
NBP1-82866
ZNF254 Antibody
H00009534-B01P
ZNF256 Antibody (3H7)
H00010172-M01
ZNF224 Antibody
NBP2-30794

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ZNF254 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF254