ZNF213 Antibody (3D3)

Images

 
Western Blot: ZNF213 Antibody (3D3) [H00007760-M02] - ZNF213 monoclonal antibody (M02), clone 3D3 Analysis of ZNF213 expression in K-562.
Immunocytochemistry/ Immunofluorescence: ZNF213 Antibody (3D3) [H00007760-M02] - Analysis of monoclonal antibody to ZNF213 on HeLa cell. Antibody concentration 10 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
3D3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ZNF213 Antibody (3D3) Summary

Immunogen
ZNF213 (NP_004211, 133 a.a. - 242 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QDVPSEEAEPEAAGRGSQATGPPPTVGARRRPSVPQEQHSHSAQPPALLKEGRPGETTDTCFVSGVHGPVALGDIPFYFSREEWGTLDPAQRDLFWDIKRENSRNTTLGF
Specificity
ZNF213 - zinc finger protein 213 (3D3)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ZNF213
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ZNF213 Antibody (3D3)

  • zinc finger protein 213
  • Zinc finger protein with KRAB and SCAN domains 21
  • ZKSCAN21CR53Putative transcription factor CR53

Background

C2H2 zinc finger proteins, such as ZNF213, have bipartite structures in which one domain binds DNA or RNA and the other modulates target gene expression.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-17262
Species: Hu
Applications: WB, ICC/IF
H00007760-M02
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for ZNF213 Antibody (H00007760-M02) (0)

There are no publications for ZNF213 Antibody (H00007760-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF213 Antibody (H00007760-M02) (0)

There are no reviews for ZNF213 Antibody (H00007760-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ZNF213 Antibody (H00007760-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZNF213 Products

Bioinformatics Tool for ZNF213 Antibody (H00007760-M02)

Discover related pathways, diseases and genes to ZNF213 Antibody (H00007760-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNF213 Antibody (H00007760-M02)

Discover more about diseases related to ZNF213 Antibody (H00007760-M02).

Blogs on ZNF213

There are no specific blogs for ZNF213, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZNF213 Antibody (3D3) and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF213
Entrez
Uniprot